##gff-version 3
# This output was generated with AUGUSTUS (version 2.3).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de)
# and Oliver Keller (keller@cs.uni-goettingen.de).
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters ...
# tomato version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C00HBa0044A14-hzP7G/AUGUSTUS_ab_initio/seq_with_defline_removed is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 176206, name = C00HBa0044A14.1) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
C00HBa0044A14.1	AUGUSTUS_ab_initio	gene	40929	42697	0.27	-	.	ID=g1
C00HBa0044A14.1	AUGUSTUS_ab_initio	transcript	40929	42697	0.27	-	.	ID=g1.t1;Parent=g1
C00HBa0044A14.1	AUGUSTUS_ab_initio	stop_codon	40929	40931	.	-	0	Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	intron	41025	41745	0.66	-	.	Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	intron	41819	42194	0.32	-	.	Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	intron	42264	42578	0.56	-	.	Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	CDS	40929	41024	0.68	-	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	CDS	41746	41818	0.97	-	1	ID=g1.t1.cds;Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	CDS	42195	42263	0.31	-	1	ID=g1.t1.cds;Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	CDS	42579	42697	0.83	-	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0044A14.1	AUGUSTUS_ab_initio	start_codon	42695	42697	.	-	0	Parent=g1.t1
# protein sequence = [MCFMMDPTLEKTIRYVQFPQRLDGIDMNDPYANRNTVSLMFSSCQVFSRVLPGFLLNHGSLCRGGDGILCRCKCKLYT
# ACDTVNAGEEVLLLRSSLGVVCKAFSEAIVEDLRKGGVAG]
# end gene g1
###
# command line:
# /usr/bin/augustus.real --species=tomato --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C00HBa0044A14-hzP7G/AUGUSTUS_ab_initio/seq_with_defline_removed