##gff-version 3
# This output was generated with AUGUSTUS (version 2.3).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de)
# and Oliver Keller (keller@cs.uni-goettingen.de).
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters ...
# tomato version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C00HBa0061A10-VviI8/AUGUSTUS_ab_initio/seq_with_defline_removed is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 139056, name = C00HBa0061A10.2) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
C00HBa0061A10.2	AUGUSTUS_ab_initio	gene	94160	96633	0.07	-	.	ID=g1
C00HBa0061A10.2	AUGUSTUS_ab_initio	transcript	94160	96633	0.07	-	.	ID=g1.t1;Parent=g1
C00HBa0061A10.2	AUGUSTUS_ab_initio	stop_codon	94160	94162	.	-	0	Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	intron	94451	95915	0.27	-	.	Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	intron	95999	96368	0.53	-	.	Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	intron	96435	96509	0.63	-	.	Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	94160	94450	0.2	-	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	95916	95998	0.57	-	2	ID=g1.t1.cds;Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	96369	96434	0.59	-	2	ID=g1.t1.cds;Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	96510	96633	1	-	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	start_codon	96631	96633	.	-	0	Parent=g1.t1
# protein sequence = [MPLVHPVEELTLEHHVKDFSFEDQVPMNSVTPRTNDQPEEQEDVSSPNKRGRTQMHDVHARKELQMEKKSGHIPECQF
# RELLKYWNSEKFKTIWRSSYKDYFEKKVANSESTLSATTDEMQQMQERMQKIEKQMEEQKKIMRQELITNVIAQIKHVGLIDPDILAALSTLAPKEYT
# SVQGAEQGWCR]
# end gene g1
###
# start gene g2
C00HBa0061A10.2	AUGUSTUS_ab_initio	gene	97695	103864	0.69	-	.	ID=g2
C00HBa0061A10.2	AUGUSTUS_ab_initio	transcript	97695	103864	0.69	-	.	ID=g2.t1;Parent=g2
C00HBa0061A10.2	AUGUSTUS_ab_initio	stop_codon	97695	97697	.	-	0	Parent=g2.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	intron	97844	101763	0.69	-	.	Parent=g2.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	intron	101787	103826	0.88	-	.	Parent=g2.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	97695	97843	0.69	-	2	ID=g2.t1.cds;Parent=g2.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	101764	101786	0.87	-	1	ID=g2.t1.cds;Parent=g2.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	CDS	103827	103864	0.88	-	0	ID=g2.t1.cds;Parent=g2.t1
C00HBa0061A10.2	AUGUSTUS_ab_initio	start_codon	103862	103864	.	-	0	Parent=g2.t1
# protein sequence = [MKFVGEAVGEARWLGINRPKDVRWSREDHPVDIIDAPSIAQHSQDEAMEQSEEKDDFDDTIWDWMEFDD]
# end gene g2
###
# command line:
# /usr/bin/augustus.real --species=tomato --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C00HBa0061A10-VviI8/AUGUSTUS_ab_initio/seq_with_defline_removed