##gff-version 3
# This output was generated with AUGUSTUS (version 2.3).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de)
# and Oliver Keller (keller@cs.uni-goettingen.de).
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters ...
# tomato version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C00HBa0030F21-A8fDs/AUGUSTUS_ab_initio/seq_with_defline_removed is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 145036, name = C00HBa0030F21.1) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
C00HBa0030F21.1	AUGUSTUS_ab_initio	gene	5822	7455	0.16	+	.	ID=g1
C00HBa0030F21.1	AUGUSTUS_ab_initio	transcript	5822	7455	0.16	+	.	ID=g1.t1;Parent=g1
C00HBa0030F21.1	AUGUSTUS_ab_initio	start_codon	5822	5824	.	+	0	Parent=g1.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	intron	5825	6052	0.47	+	.	Parent=g1.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	intron	6161	7194	0.16	+	.	Parent=g1.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	CDS	5822	5824	0.5	+	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	CDS	6053	6160	0.26	+	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	CDS	7195	7455	0.28	+	0	ID=g1.t1.cds;Parent=g1.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	stop_codon	7453	7455	.	+	0	Parent=g1.t1
# protein sequence = [MEDYSKVKFLNLNHGRNRVDKTLKILWGLEIINGPRVEYRVAPDGECEHGSTFCLKGLLDEELGGNCGNGDIDNSGFI
# DGKLASAENLLRSFTDGLIASGVTEGFTSGFLPLFLKGLPVIGPV]
# end gene g1
###
# start gene g2
C00HBa0030F21.1	AUGUSTUS_ab_initio	gene	47778	48588	0.27	-	.	ID=g2
C00HBa0030F21.1	AUGUSTUS_ab_initio	transcript	47778	48588	0.27	-	.	ID=g2.t1;Parent=g2
C00HBa0030F21.1	AUGUSTUS_ab_initio	stop_codon	47778	47780	.	-	0	Parent=g2.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	intron	47836	48064	0.75	-	.	Parent=g2.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	intron	48365	48457	0.5	-	.	Parent=g2.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	CDS	47778	47835	0.76	-	1	ID=g2.t1.cds;Parent=g2.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	CDS	48065	48364	0.42	-	1	ID=g2.t1.cds;Parent=g2.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	CDS	48458	48588	0.66	-	0	ID=g2.t1.cds;Parent=g2.t1
C00HBa0030F21.1	AUGUSTUS_ab_initio	start_codon	48586	48588	.	-	0	Parent=g2.t1
# protein sequence = [MLMEANQQHNTTFVTRLLKWDDILSGDDWKFESITETLPSQPSRRISSARPSSSKTRGDDEVSKIAEALEQSKFHGMD
# LTSTIPNVYYESHSDQGSTSPSEIKPSFHKKKDSIDVIKFAENFTPDKKRITKWWNNPNHALKKPWKEVLKGAPLSLQKRTPAQ]
# end gene g2
###
# command line:
# /usr/bin/augustus.real --species=tomato --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C00HBa0030F21-A8fDs/AUGUSTUS_ab_initio/seq_with_defline_removed