<?xml version="1.0" encoding="ISO-8859-1"?>
<GTH_output xmlns="http://www.genomethreader.org/GTH_output/" GTH_XML_version="1.1">
  <header xmlns="http://www.genomethreader.org/GTH_output/header/">
    <source program="GenomeThreader" version="0.9.54" build_date="2006-07-28 11:55:15" run_date="2006-11-03 16:50:53"/>
    <gDNA_template_files>
      <temp_name>/tmp/bac-submission-temp-jRrpd/GenomeThreader_SGN_markers/un_xed_seqs</temp_name>
    </gDNA_template_files>
    <reference_files>
      <file ref_name="/tmp/cxgn-bacpublish-resources-0WnINt/sgn_marker_seqs" type="ESTcDNA"/>
    </reference_files>
    <splice_site_parameters parameter_type="Bayesian" species="arabidopsis"/>
    <parameters>
      <parameter name="bssmfile" value="arabidopsis"/>
      <parameter name="scorematrixfile" value="BLOSUM62"/>
      <parameter name="searchmode" value="forward=True,reverse=True)"/>
      <parameter name="translationtable" value="1"/>
      <parameter name="frompos" value="0"/>
      <parameter name="topos" value="0"/>
      <parameter name="width" value="0"/>
      <parameter name="verbose" value="False"/>
      <parameter name="skipalignmentout" value="False"/>
      <parameter name="showintronmaxlen" value="120"/>
      <parameter name="minorflen" value="64"/>
      <parameter name="showseqnums" value="False"/>
      <parameter name="gs2out" value="False"/>
      <parameter name="maskpolyatails" value="False"/>
      <parameter name="noautoindex" value="False"/>
      <parameter name="minmatchlen" value="20"/>
      <parameter name="seedlength" value="16"/>
      <parameter name="exdrop" value="2"/>
      <parameter name="online" value="False"/>
      <parameter name="inverse" value="False"/>
      <parameter name="exact" value="False"/>
      <parameter name="chainwf" value="0.500000"/>
      <parameter name="gcmaxgapwidth" value="1000000"/>
      <parameter name="gcmincoverage" value="50"/>
      <parameter name="introncutout" value="False"/>
      <parameter name="autointroncutout" value="0"/>
      <parameter name="icinitialdelta" value="50"/>
      <parameter name="iciterations" value="2"/>
      <parameter name="icdeltaincrease" value="50"/>
      <parameter name="icminremintronlen" value="10"/>
      <parameter name="nou12intronmodel" value="False"/>
      <parameter name="u12donorprob" value="0.990000"/>
      <parameter name="u12donorprob1mism" value="0.900000"/>
      <parameter name="probies" value="0.500000"/>
      <parameter name="probdelgen" value="0.030000"/>
      <parameter name="identityweight" value="2.000000"/>
      <parameter name="mismatchweight" value="-2.000000"/>
      <parameter name="undetcharweight" value="0.000000"/>
      <parameter name="deletionweight" value="-4.000000"/>
      <parameter name="dpminexonlen" value="5"/>
      <parameter name="dpminintronlen" value="50"/>
      <parameter name="shortexonpenal" value="100"/>
      <parameter name="shortintronpenal" value="100"/>
      <parameter name="wzerotransition" value="80"/>
      <parameter name="wdecreasedoutput" value="80"/>
      <parameter name="leadcutoffsmode" value="RELAXED"/>
      <parameter name="termcutoffsmode" value="STRICT"/>
      <parameter name="cutoffsminexonlen" value="5"/>
      <parameter name="scoreminexonlen" value="50"/>
      <parameter name="minaveragessp" value="0.500000"/>
      <parameter name="minalignmentscore" value="0.900000"/>
      <parameter name="maxalignmentscore" value="1.000000"/>
      <parameter name="mincoverage" value="0.900000"/>
      <parameter name="maxcoverage" value="100.000000"/>
      <parameter name="intermediate" value="False"/>
      <parameter name="sortags" value="False"/>
      <parameter name="sortagswf" value="1.000000"/>
      <parameter name="first" value="0"/>
      <parameter name="exondistri" value="False"/>
      <parameter name="introndistri" value="False"/>
      <parameter name="refseqcovdistri" value="False"/>
    </parameters>
    <overall_reference_type>ESTcDNA</overall_reference_type>
  </header>
  <alignment_module>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/cxgn-bacpublish-resources-0WnINt/sgn_marker_seqs" ref_id="TG494-R" ref_strand="+" ref_description="TG494-R [rflp] - REVERSE SEQUENCE">
      <seq>ggagacagcttgcatgcctgcagttccctttctatattaaccatctgaaataacatagagagattctgtaagttcctctgtatattttttaataaggtcctctgtttcttctttattccctgcattgtcatctttgtactgcctctaccaggcatcatccaaacaatcccaaaccggtttagaaatatacaccaagttatccatatgaatttgcaacgtaggagtaactgtccaaatgatttaaagccctctttgcagtagtagtatctgctggagaagtgaaatcttcctctgtgctggctatcatatgttactatgtttcattcaaggctaatacccaaaaaacagccactttgggagtagctctggtcctccaagtcatcttccatgactattagagccaatattaccacattcttccttaacaactaactgtatcatgctttaggtgagaagttcgcatcatccaatgatccatttccatcactccccctaatttaacaa</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-jRrpd/GenomeThreader_SGN_markers/un_xed_seqs" temp_id="C02HBa0204D01.1" temp_strand="+" temp_description="C02HBa0204D01.1  submitted_to_sgn_as:C02HBa0204D01">
        <position start="83239" stop="84329"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="83543" g_stop="84029" g_length="487"/>
          <reference_exon_boundary r_type="cDNA" r_start="18" r_stop="504" r_length="487" r_score="1.000"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C02HBa0204D01.1" gen_strand="+" ref_id="TG494-R" ref_strand="+">
        <total_alignment_score>1.000</total_alignment_score>
        <cumulative_length_of_scored_exons>487</cumulative_length_of_scored_exons>
        <coverage percentage="0.966" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C02HBa0204D01.1" gen_strand="+"/>
        <rDNA rDNA_id="TG494-R" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="83543" e_stop="84029"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>CTGCAGTTCCCTTTCTATATTAACCATCTGAAATAACATAGAGAGATTCTGTAAGTTCCTCTGTATATTTTTTAATAAGGTCCTCTGTTTCTTCTTTATTCCCTGCATTGTCATCTTTGTACTGCCTCTACCAGGCATCATCCAAACAATCCCAAACCGGTTTAGAAATATACACCAAGTTATCCATATGAATTTGCAACGTAGGAGTAACTGTCCAAATGATTTAAAGCCCTCTTTGCAGTAGTAGTATCTGCTGGAGAAGTGAAATCTTCCTCTGTGCTGGCTATCATATGTTACTATGTTTCATTCAAGGCTAATACCCAAAAAACAGCCACTTTGGGAGTAGCTCTGGTCCTCCAAGTCATCTTCCATGACTATTAGAGCCAATATTACCACATTCTTCCTTAACAACTAACTGTATCATGCTTTAGGTGAGAAGTTCGCATCATCCAATGATCCATTTCCATCACTCCCCCTAATTTAACAA</genome_strand>
        <mrna_strand>CTGCAGTTCCCTTTCTATATTAACCATCTGAAATAACATAGAGAGATTCTGTAAGTTCCTCTGTATATTTTTTAATAAGGTCCTCTGTTTCTTCTTTATTCCCTGCATTGTCATCTTTGTACTGCCTCTACCAGGCATCATCCAAACAATCCCAAACCGGTTTAGAAATATACACCAAGTTATCCATATGAATTTGCAACGTAGGAGTAACTGTCCAAATGATTTAAAGCCCTCTTTGCAGTAGTAGTATCTGCTGGAGAAGTGAAATCTTCCTCTGTGCTGGCTATCATATGTTACTATGTTTCATTCAAGGCTAATACCCAAAAAACAGCCACTTTGGGAGTAGCTCTGGTCCTCCAAGTCATCTTCCATGACTATTAGAGCCAATATTACCACATTCTTCCTTAACAACTAACTGTATCATGCTTTAGGTGAGAAGTTCGCATCATCCAATGATCCATTTCCATCACTCCCCCTAATTTAACAA</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/cxgn-bacpublish-resources-0WnINt/sgn_marker_seqs" ref_id="TG195-R" ref_strand="+" ref_description="TG195-R [rflp] - REVERSE SEQUENCE">
      <seq>ctgaaatacatagagagattctgtaagttcctctgtatattttttaataaggtcctctgtttcttctttattccctgcatggtcatctttgaactgcctctaccaggcatcatccaaacaatcccaaaccggtttagaaatatacaccaagttatccatatgaatttgcaacgtaggagtaactgtccaaatgatttaaagccctctttgcagtagtagtatctgctggagaagtgaaatcttcctctgtgctggctatcatatgttactatgtttcattcaaggctaatacccaaaaaacagccactttgggagtagctctggtcctccaagtcatcttccatgactattagagccaatattaccacattcttccttaacaactaactgtatcatgctttacgtgagaagttcgcatcatccaatgatccatttccatcactccccctaatttaacaactagcacacacagact</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-jRrpd/GenomeThreader_SGN_markers/un_xed_seqs" temp_id="C02HBa0204D01.1" temp_strand="+" temp_description="C02HBa0204D01.1  submitted_to_sgn_as:C02HBa0204D01">
        <position start="83270" stop="84345"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="83570" g_stop="84045" g_length="476"/>
          <reference_exon_boundary r_type="cDNA" r_start="1" r_stop="475" r_length="475" r_score="0.992"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C02HBa0204D01.1" gen_strand="+" ref_id="TG195-R" ref_strand="+">
        <total_alignment_score>0.992</total_alignment_score>
        <cumulative_length_of_scored_exons>476</cumulative_length_of_scored_exons>
        <coverage percentage="1.002" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C02HBa0204D01.1" gen_strand="+"/>
        <rDNA rDNA_id="TG195-R" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="83570" e_stop="84045"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>CTGAAATAACATAGAGAGATTCTGTAAGTTCCTCTGTATATTTTTTAATAAGGTCCTCTGTTTCTTCTTTATTCCCTGCATTGTCATCTTTGTACTGCCTCTACCAGGCATCATCCAAACAATCCCAAACCGGTTTAGAAATATACACCAAGTTATCCATATGAATTTGCAACGTAGGAGTAACTGTCCAAATGATTTAAAGCCCTCTTTGCAGTAGTAGTATCTGCTGGAGAAGTGAAATCTTCCTCTGTGCTGGCTATCATATGTTACTATGTTTCATTCAAGGCTAATACCCAAAAAACAGCCACTTTGGGAGTAGCTCTGGTCCTCCAAGTCATCTTCCATGACTATTAGAGCCAATATTACCACATTCTTCCTTAACAACTAACTGTATCATGCTTTAGGTGAGAAGTTCGCATCATCCAATGATCCATTTCCATCACTCCCCCTAATTTAACAACTAGCACACACAGACT</genome_strand>
        <mrna_strand>CTGAAAT-ACATAGAGAGATTCTGTAAGTTCCTCTGTATATTTTTTAATAAGGTCCTCTGTTTCTTCTTTATTCCCTGCATGGTCATCTTTGAACTGCCTCTACCAGGCATCATCCAAACAATCCCAAACCGGTTTAGAAATATACACCAAGTTATCCATATGAATTTGCAACGTAGGAGTAACTGTCCAAATGATTTAAAGCCCTCTTTGCAGTAGTAGTATCTGCTGGAGAAGTGAAATCTTCCTCTGTGCTGGCTATCATATGTTACTATGTTTCATTCAAGGCTAATACCCAAAAAACAGCCACTTTGGGAGTAGCTCTGGTCCTCCAAGTCATCTTCCATGACTATTAGAGCCAATATTACCACATTCTTCCTTAACAACTAACTGTATCATGCTTTACGTGAGAAGTTCGCATCATCCAATGATCCATTTCCATCACTCCCCCTAATTTAACAACTAGCACACACAGACT</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/cxgn-bacpublish-resources-0WnINt/sgn_marker_seqs" ref_id="TG494-F" ref_strand="+" ref_description="TG494-F [rflp] - FORWARD SEQUENCE">
      <seq>cgaaccaagattagacatagaaaacaagctcatgtgcatgagagttagagatttgaggccggtttagctttactttaaacctatgctttctctttttttgatcatgttcctattctctagtctaccttttcctattatttgttcccaggagtagttatggtttgactgaagcctgaaggaaggcataggttgcaaccctttatttcataaagatagcctcaatgttttcacctcttacaaactaaagcaccgattgtgtaaaacctcatttccctgcttggacctccccgtagacaagctaagagtgtctcatttggttaaccagtttgcaaagcttaataatggagctaggacactgttatactttggatgataaaaggttgaccagcatagggagaaagaaacaggtacataaagccttaccacaaagcatctaatgaggaaacaggtgaaac</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-jRrpd/GenomeThreader_SGN_markers/un_xed_seqs" temp_id="C02HBa0204D01.1" temp_strand="-" temp_description="C02HBa0204D01.1  submitted_to_sgn_as:C02HBa0204D01">
        <position start="85697" stop="84643"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="85397" g_stop="84943" g_length="455"/>
          <reference_exon_boundary r_type="cDNA" r_start="1" r_stop="455" r_length="455" r_score="1.000"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C02HBa0204D01.1" gen_strand="-" ref_id="TG494-F" ref_strand="+">
        <total_alignment_score>1.000</total_alignment_score>
        <cumulative_length_of_scored_exons>455</cumulative_length_of_scored_exons>
        <coverage percentage="1.000" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C02HBa0204D01.1" gen_strand="-"/>
        <rDNA rDNA_id="TG494-F" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="85397" e_stop="84943"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>CGAACCAAGATTAGACATAGAAAACAAGCTCATGTGCATGAGAGTTAGAGATTTGAGGCCGGTTTAGCTTTACTTTAAACCTATGCTTTCTCTTTTTTTGATCATGTTCCTATTCTCTAGTCTACCTTTTCCTATTATTTGTTCCCAGGAGTAGTTATGGTTTGACTGAAGCCTGAAGGAAGGCATAGGTTGCAACCCTTTATTTCATAAAGATAGCCTCAATGTTTTCACCTCTTACAAACTAAAGCACCGATTGTGTAAAACCTCATTTCCCTGCTTGGACCTCCCCGTAGACAAGCTAAGAGTGTCTCATTTGGTTAACCAGTTTGCAAAGCTTAATAATGGAGCTAGGACACTGTTATACTTTGGATGATAAAAGGTTGACCAGCATAGGGAGAAAGAAACAGGTACATAAAGCCTTACCACAAAGCATCTAATGAGGAAACAGGTGAAAC</genome_strand>
        <mrna_strand>CGAACCAAGATTAGACATAGAAAACAAGCTCATGTGCATGAGAGTTAGAGATTTGAGGCCGGTTTAGCTTTACTTTAAACCTATGCTTTCTCTTTTTTTGATCATGTTCCTATTCTCTAGTCTACCTTTTCCTATTATTTGTTCCCAGGAGTAGTTATGGTTTGACTGAAGCCTGAAGGAAGGCATAGGTTGCAACCCTTTATTTCATAAAGATAGCCTCAATGTTTTCACCTCTTACAAACTAAAGCACCGATTGTGTAAAACCTCATTTCCCTGCTTGGACCTCCCCGTAGACAAGCTAAGAGTGTCTCATTTGGTTAACCAGTTTGCAAAGCTTAATAATGGAGCTAGGACACTGTTATACTTTGGATGATAAAAGGTTGACCAGCATAGGGAGAAAGAAACAGGTACATAAAGCCTTACCACAAAGCATCTAATGAGGAAACAGGTGAAAC</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
    <total_number_ESTs_reported>3</total_number_ESTs_reported>
    </alignment_module>
  <PGL_module xmlns="http://www.genomethreader.org/GTH_output/PGL_module/">
    <predicted_gene_location>
      <PGL_line PGL_serial="1" PGL_strand="+" PGL_start="83543" PGL_stop="84045"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="83543" e_stop="84045"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-only e_score="1.000"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="1.000">
            <gDNA_exon_boundary e_start="83543" e_stop="84045" e_length="503"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="83543" stop="84029"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="TG494-R" strand="+"/>
          </PGS_line>
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="83570" stop="84045"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="TG195-R" strand="+"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="1" AGS_serial="1" gDNA_strand="+"/>
          <translation>
            <gDNA_template>CTGCAGTTCCCTTTCTATATTAACCATCTGAAATAACATAGAGAGATTCTGTAAGTTCCTCTGTATATTTTTTAATAAGGTCCTCTGTTTCTTCTTTATTCCCTGCATTGTCATCTTTGTACTGCCTCTACCAGGCATCATCCAAACAATCCCAAACCGGTTTAGAAATATACACCAAGTTATCCATATGAATTTGCAACGTAGGAGTAACTGTCCAAATGATTTAAAGCCCTCTTTGCAGTAGTAGTATCTGCTGGAGAAGTGAAATCTTCCTCTGTGCTGGCTATCATATGTTACTATGTTTCATTCAAGGCTAATACCCAAAAAACAGCCACTTTGGGAGTAGCTCTGGTCCTCCAAGTCATCTTCCATGACTATTAGAGCCAATATTACCACATTCTTCCTTAACAACTAACTGTATCATGCTTTAGGTGAGAAGTTCGCATCATCCAATGATCCATTTCCATCACTCCCCCTAATTTAACAACTAGCACACACAGACT</gDNA_template>
            <first_frame> L  Q  F  P  F  Y  I  N  H  L  K  *  H  R  E  I  L  *  V  P  L  Y  I  F  *  *  G  P  L  F  L  L  Y  S  L  H  C  H  L  C  T  A  S  T  R  H  H  P  N  N  P  K  P  V  *  K  Y  T  P  S  Y  P  Y  E  F  A  T  *  E  *  L  S  K  *  F  K  A  L  F  A  V  V  V  S  A  G  E  V  K  S  S  S  V  L  A  I  I  C  Y  Y  V  S  F  K  A  N  T  Q  K  T  A  T  L  G  V  A  L  V  L  Q  V  I  F  H  D  Y  *  S  Q  Y  Y  H  I  L  P  *  Q  L  T  V  S  C  F  R  *  E  V  R  I  I  Q  *  S  I  S  I  T  P  P  N  L  T  T  S  T  H  R   </first_frame>
            <second_frame>  C  S  S  L  S  I  L  T  I  *  N  N  I  E  R  F  C  K  F  L  C  I  F  F  N  K  V  L  C  F  F  F  I  P  C  I  V  I  F  V  L  P  L  P  G  I  I  Q  T  I  P  N  R  F  R  N  I  H  Q  V  I  H  M  N  L  Q  R  R  S  N  C  P  N  D  L  K  P  S  L  Q  *  *  Y  L  L  E  K  *  N  L  P  L  C  W  L  S  Y  V  T  M  F  H  S  R  L  I  P  K  K  Q  P  L  W  E  *  L  W  S  S  K  S  S  S  M  T  I  R  A  N  I  T  T  F  F  L  N  N  *  L  Y  H  A  L  G  E  K  F  A  S  S  N  D  P  F  P  S  L  P  L  I  *  Q  L  A  H  T  D  </second_frame>
            <third_frame>   A  V  P  F  L  Y  *  P  S  E  I  T  *  R  D  S  V  S  S  S  V  Y  F  L  I  R  S  S  V  S  S  L  F  P  A  L  S  S  L  Y  C  L  Y  Q  A  S  S  K  Q  S  Q  T  G  L  E  I  Y  T  K  L  S  I  *  I  C  N  V  G  V  T  V  Q  M  I  *  S  P  L  C  S  S  S  I  C  W  R  S  E  I  F  L  C  A  G  Y  H  M  L  L  C  F  I  Q  G  *  Y  P  K  N  S  H  F  G  S  S  S  G  P  P  S  H  L  P  *  L  L  E  P  I  L  P  H  S  S  L  T  T  N  C  I  M  L  *  V  R  S  S  H  H  P  M  I  H  F  H  H  S  P  *  F  N  N  *  H  T  Q  T </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <orf_entry>
              <id_line>
                <gDNA id="C02HBa0204D01.1" strand="+"/>
                <serials PGL_serial="1" AGS_serial="1" PPS_serial="1"/>
                <orf_info>
                  <exon_boundaries>
                    <exon start="83574" stop="83786"/>
                  </exon_boundaries>
                  <frame>1</frame>
                  <number_coding_nucleotides>210</number_coding_nucleotides>
                  <number_encoded_amino_acids>70</number_encoded_amino_acids>
                </orf_info>
              </id_line>
              <predicted_protein_sequence>NNIERFCKFLCIFFNKVLCFFFIPCIVIFVLPLPGIIQTIPNRFRNIHQVIHMNLQRRSNCPNDLKPSLQ*</predicted_protein_sequence>
            </orf_entry>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
    <predicted_gene_location>
      <PGL_line PGL_serial="2" PGL_strand="-" PGL_start="85397" PGL_stop="84943"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="85397" e_stop="84943"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-only e_score="1.000"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="1.000">
            <gDNA_exon_boundary e_start="85397" e_stop="84943" e_length="455"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="85397" stop="84943"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="TG494-F" strand="+"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="2" AGS_serial="1" gDNA_strand="-"/>
          <translation>
            <gDNA_template>CGAACCAAGATTAGACATAGAAAACAAGCTCATGTGCATGAGAGTTAGAGATTTGAGGCCGGTTTAGCTTTACTTTAAACCTATGCTTTCTCTTTTTTTGATCATGTTCCTATTCTCTAGTCTACCTTTTCCTATTATTTGTTCCCAGGAGTAGTTATGGTTTGACTGAAGCCTGAAGGAAGGCATAGGTTGCAACCCTTTATTTCATAAAGATAGCCTCAATGTTTTCACCTCTTACAAACTAAAGCACCGATTGTGTAAAACCTCATTTCCCTGCTTGGACCTCCCCGTAGACAAGCTAAGAGTGTCTCATTTGGTTAACCAGTTTGCAAAGCTTAATAATGGAGCTAGGACACTGTTATACTTTGGATGATAAAAGGTTGACCAGCATAGGGAGAAAGAAACAGGTACATAAAGCCTTACCACAAAGCATCTAATGAGGAAACAGGTGAAAC</gDNA_template>
            <first_frame> R  T  K  I  R  H  R  K  Q  A  H  V  H  E  S  *  R  F  E  A  G  L  A  L  L  *  T  Y  A  F  S  F  F  D  H  V  P  I  L  *  S  T  F  S  Y  Y  L  F  P  G  V  V  M  V  *  L  K  P  E  G  R  H  R  L  Q  P  F  I  S  *  R  *  P  Q  C  F  H  L  L  Q  T  K  A  P  I  V  *  N  L  I  S  L  L  G  P  P  R  R  Q  A  K  S  V  S  F  G  *  P  V  C  K  A  *  *  W  S  *  D  T  V  I  L  W  M  I  K  G  *  P  A  *  G  E  R  N  R  Y  I  K  P  Y  H  K  A  S  N  E  E  T  G  E   </first_frame>
            <second_frame>  E  P  R  L  D  I  E  N  K  L  M  C  M  R  V  R  D  L  R  P  V  *  L  Y  F  K  P  M  L  S  L  F  L  I  M  F  L  F  S  S  L  P  F  P  I  I  C  S  Q  E  *  L  W  F  D  *  S  L  K  E  G  I  G  C  N  P  L  F  H  K  D  S  L  N  V  F  T  S  Y  K  L  K  H  R  L  C  K  T  S  F  P  C  L  D  L  P  V  D  K  L  R  V  S  H  L  V  N  Q  F  A  K  L  N  N  G  A  R  T  L  L  Y  F  G  *  *  K  V  D  Q  H  R  E  K  E  T  G  T  *  S  L  T  T  K  H  L  M  R  K  Q  V  K  </second_frame>
            <third_frame>   N  Q  D  *  T  *  K  T  S  S  C  A  *  E  L  E  I  *  G  R  F  S  F  T  L  N  L  C  F  L  F  F  *  S  C  S  Y  S  L  V  Y  L  F  L  L  F  V  P  R  S  S  Y  G  L  T  E  A  *  R  K  A  *  V  A  T  L  Y  F  I  K  I  A  S  M  F  S  P  L  T  N  *  S  T  D  C  V  K  P  H  F  P  A  W  T  S  P  *  T  S  *  E  C  L  I  W  L  T  S  L  Q  S  L  I  M  E  L  G  H  C  Y  T  L  D  D  K  R  L  T  S  I  G  R  K  K  Q  V  H  K  A  L  P  Q  S  I  *  *  G  N  R  *  N </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <orf_entry>
              <id_line>
                <gDNA id="C02HBa0204D01.1" strand="-"/>
                <serials PGL_serial="2" AGS_serial="1" PPS_serial="1"/>
                <orf_info>
                  <exon_boundaries>
                    <exon start="85228" stop="85025"/>
                  </exon_boundaries>
                  <frame>1</frame>
                  <number_coding_nucleotides>201</number_coding_nucleotides>
                  <number_encoded_amino_acids>67</number_encoded_amino_acids>
                </orf_info>
              </id_line>
              <predicted_protein_sequence>SLKEGIGCNPLFHKDSLNVFTSYKLKHRLCKTSFPCLDLPVDKLRVSHLVNQFAKLNNGARTLLYFG*</predicted_protein_sequence>
            </orf_entry>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
  </PGL_module>
</GTH_output>
<!--
$ general statistics:
$ 8 chains have been computed
$ 
$ memory statistics:
$ 5608 bytes spliced alignments in total
$ 3 spliced alignments have been stored
$ 1869 bytes was the average size of a spliced alignment
$ 6704 bytes predicted gene locations in total
$ 2 predicted gene locations have been stored
$ 3352 bytes was the average size of a predicted gene location
$ 10 megabytes was the average size of the backtrace matrix
$ 9 backtrace matrices have been allocated
$ 
$ date finished: 2006-11-03 16:51:14
-->
