<?xml version="1.0" encoding="ISO-8859-1"?>
<GTH_output xmlns="http://www.genomethreader.org/GTH_output/" GTH_XML_version="1.1">
  <header xmlns="http://www.genomethreader.org/GTH_output/header/">
    <source program="GenomeThreader" version="0.9.54" build_date="2006-07-28 11:55:15" run_date="2009-01-16 23:28:10"/>
    <gDNA_template_files>
      <temp_name>/tmp/bac-submission-temp-C07HBa0073N22-JR2l6/GenomeThreader_SGN_markers/un_xed_seqs</temp_name>
    </gDNA_template_files>
    <reference_files>
      <file ref_name="/tmp/bac-submission-temp-C07HBa0073N22-JR2l6/gth_cdna_fileCXGN::BACSubmission::Analysis::GenomeThreader_SGN_markers" type="ESTcDNA"/>
    </reference_files>
    <splice_site_parameters parameter_type="Bayesian" species="arabidopsis"/>
    <parameters>
      <parameter name="bssmfile" value="arabidopsis"/>
      <parameter name="scorematrixfile" value="BLOSUM62"/>
      <parameter name="searchmode" value="forward=True,reverse=True)"/>
      <parameter name="translationtable" value="1"/>
      <parameter name="frompos" value="0"/>
      <parameter name="topos" value="0"/>
      <parameter name="width" value="0"/>
      <parameter name="verbose" value="False"/>
      <parameter name="skipalignmentout" value="False"/>
      <parameter name="showintronmaxlen" value="120"/>
      <parameter name="minorflen" value="64"/>
      <parameter name="showseqnums" value="False"/>
      <parameter name="gs2out" value="False"/>
      <parameter name="maskpolyatails" value="False"/>
      <parameter name="noautoindex" value="False"/>
      <parameter name="minmatchlen" value="20"/>
      <parameter name="seedlength" value="16"/>
      <parameter name="exdrop" value="2"/>
      <parameter name="online" value="False"/>
      <parameter name="inverse" value="False"/>
      <parameter name="exact" value="False"/>
      <parameter name="chainwf" value="0.500000"/>
      <parameter name="gcmaxgapwidth" value="1000000"/>
      <parameter name="gcmincoverage" value="50"/>
      <parameter name="introncutout" value="False"/>
      <parameter name="autointroncutout" value="0"/>
      <parameter name="icinitialdelta" value="50"/>
      <parameter name="iciterations" value="2"/>
      <parameter name="icdeltaincrease" value="50"/>
      <parameter name="icminremintronlen" value="10"/>
      <parameter name="nou12intronmodel" value="False"/>
      <parameter name="u12donorprob" value="0.990000"/>
      <parameter name="u12donorprob1mism" value="0.900000"/>
      <parameter name="probies" value="0.500000"/>
      <parameter name="probdelgen" value="0.030000"/>
      <parameter name="identityweight" value="2.000000"/>
      <parameter name="mismatchweight" value="-2.000000"/>
      <parameter name="undetcharweight" value="0.000000"/>
      <parameter name="deletionweight" value="-4.000000"/>
      <parameter name="dpminexonlen" value="5"/>
      <parameter name="dpminintronlen" value="50"/>
      <parameter name="shortexonpenal" value="100"/>
      <parameter name="shortintronpenal" value="100"/>
      <parameter name="wzerotransition" value="80"/>
      <parameter name="wdecreasedoutput" value="80"/>
      <parameter name="leadcutoffsmode" value="RELAXED"/>
      <parameter name="termcutoffsmode" value="STRICT"/>
      <parameter name="cutoffsminexonlen" value="5"/>
      <parameter name="scoreminexonlen" value="50"/>
      <parameter name="minaveragessp" value="0.500000"/>
      <parameter name="minalignmentscore" value="0.900000"/>
      <parameter name="maxalignmentscore" value="1.000000"/>
      <parameter name="mincoverage" value="0.900000"/>
      <parameter name="maxcoverage" value="100.000000"/>
      <parameter name="intermediate" value="False"/>
      <parameter name="sortags" value="False"/>
      <parameter name="sortagswf" value="1.000000"/>
      <parameter name="first" value="0"/>
      <parameter name="exondistri" value="False"/>
      <parameter name="introndistri" value="False"/>
      <parameter name="refseqcovdistri" value="False"/>
    </parameters>
    <overall_reference_type>ESTcDNA</overall_reference_type>
  </header>
  <alignment_module>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/bac-submission-temp-C07HBa0073N22-JR2l6/gth_cdna_fileCXGN::BACSubmission::Analysis::GenomeThreader_SGN_markers" ref_id="SGN-M444-F" ref_strand="+" ref_description="SGN-M444-F TG64-F [rflp_markers_forward]">
      <seq>gtcctgaaaagttatcaaggattcatcagtaacctgattatatcaactcgtttaaatttattcatacttaatagatcaacccctatgatctcattctgactataagcctaaaggtgaacaagtgagaaaaggcctaaattatttttcttcaaaatgttggtaatgtgattacctgataatttaggcatcttagtgtacgtaaatggcatgaatggtgaaggtgcttgcaaaggcagcatagctttgctaggagtgatgtctggagaggcatgattatgagttgtacttaataaatcactctcttgagatttatgaattcctgaaactggaaaaaggctatgagtgcatttcatcaagacaattacgaatcaattgaaattgaaaatcacgtacagagaagcaacactattgagacttgaatcatgagactcatttcttcaaattttgtttacgtgtataaccgaaagatatattttgtgtgtaaattgattaagcataaggtgttt</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-C07HBa0073N22-JR2l6/GenomeThreader_SGN_markers/un_xed_seqs" temp_id="C07HBa0073N22.1" temp_strand="+" temp_description="C07HBa0073N22.1  AC212624.1 htgs_phase:3 submitted_to_sgn_as:gi|158262120|gb|AC212624.1| upload_account_name:france Solanum lycopersicum chromosome 7 clone C07HBa0073N22, complete sequence">
        <position start="5771" stop="6876"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="6071" g_stop="6576" g_length="506"/>
          <reference_exon_boundary r_type="cDNA" r_start="1" r_stop="506" r_length="506" r_score="1.000"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C07HBa0073N22.1" gen_strand="+" ref_id="SGN-M444-F" ref_strand="+">
        <total_alignment_score>1.000</total_alignment_score>
        <cumulative_length_of_scored_exons>506</cumulative_length_of_scored_exons>
        <coverage percentage="1.000" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C07HBa0073N22.1" gen_strand="+"/>
        <rDNA rDNA_id="SGN-M444-F" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="6071" e_stop="6576"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>GTCCTGAAAAGTTATCAAGGATTCATCAGTAACCTGATTATATCAACTCGTTTAAATTTATTCATACTTAATAGATCAACCCCTATGATCTCATTCTGACTATAAGCCTAAAGGTGAACAAGTGAGAAAAGGCCTAAATTATTTTTCTTCAAAATGTTGGTAATGTGATTACCTGATAATTTAGGCATCTTAGTGTACGTAAATGGCATGAATGGTGAAGGTGCTTGCAAAGGCAGCATAGCTTTGCTAGGAGTGATGTCTGGAGAGGCATGATTATGAGTTGTACTTAATAAATCACTCTCTTGAGATTTATGAATTCCTGAAACTGGAAAAAGGCTATGAGTGCATTTCATCAAGACAATTACGAATCAATTGAAATTGAAAATCACGTACAGAGAAGCAACACTATTGAGACTTGAATCATGAGACTCATTTCTTCAAATTTTGTTTACGTGTATAACCGAAAGATATATTTTGTGTGTAAATTGATTAAGCATAAGGTGTTT</genome_strand>
        <mrna_strand>GTCCTGAAAAGTTATCAAGGATTCATCAGTAACCTGATTATATCAACTCGTTTAAATTTATTCATACTTAATAGATCAACCCCTATGATCTCATTCTGACTATAAGCCTAAAGGTGAACAAGTGAGAAAAGGCCTAAATTATTTTTCTTCAAAATGTTGGTAATGTGATTACCTGATAATTTAGGCATCTTAGTGTACGTAAATGGCATGAATGGTGAAGGTGCTTGCAAAGGCAGCATAGCTTTGCTAGGAGTGATGTCTGGAGAGGCATGATTATGAGTTGTACTTAATAAATCACTCTCTTGAGATTTATGAATTCCTGAAACTGGAAAAAGGCTATGAGTGCATTTCATCAAGACAATTACGAATCAATTGAAATTGAAAATCACGTACAGAGAAGCAACACTATTGAGACTTGAATCATGAGACTCATTTCTTCAAATTTTGTTTACGTGTATAACCGAAAGATATATTTTGTGTGTAAATTGATTAAGCATAAGGTGTTT</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/bac-submission-temp-C07HBa0073N22-JR2l6/gth_cdna_fileCXGN::BACSubmission::Analysis::GenomeThreader_SGN_markers" ref_id="SGN-M1931" ref_strand="+" ref_description="SGN-M1931 T1329 [cos_markers]">
      <seq>agaagtgatgaaacagttggaatggtagagtcatatctccgtgcaaataatatgtttgttgattataaagagcctcaacaagaaaaggtgtactcttcttatttgaacctagaccttgccgatgttgaaccatgtctgtcagggccaaagagacctcatgaccgtgtgcctttgaaagaaatgaagtctgactggcatgcttgcctagataacaaagttggattcaagggatttgctgtgccaaaagaggtgcaagataaagtggccaagttttccttccatgggcaacctgcagagctcaaacatggcagtgttgtgattgctgctatcacaagttgcacaaatacatccaatcccagtgttatgctaggagcagctctggttgccaaaaaggcatctgagctgggtctacatgttaagccatgggttaaaactagccttgccccaagctctggtgttgttacaaaatatttactcaagagtggtctacagaagtatttaaatc</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-C07HBa0073N22-JR2l6/GenomeThreader_SGN_markers/un_xed_seqs" temp_id="C07HBa0073N22.1" temp_strand="-" temp_description="C07HBa0073N22.1  AC212624.1 htgs_phase:3 submitted_to_sgn_as:gi|158262120|gb|AC212624.1| upload_account_name:france Solanum lycopersicum chromosome 7 clone C07HBa0073N22, complete sequence">
        <position start="19858" stop="18255"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="19650" g_stop="19636" g_length="15"/>
          <reference_exon_boundary r_type="cDNA" r_start="1" r_stop="15" r_length="15" r_score="1.000"/>
        </exon>
        <intron i_serial="1">
          <gDNA_intron_boundary i_start="19635" i_stop="19546" i_length="90">
            <donor d_prob="0.461" d_score="0.00"/>
            <acceptor a_prob="0.894" a_score="0.98"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="2">
          <gDNA_exon_boundary g_start="19545" g_stop="19489" g_length="57"/>
          <reference_exon_boundary r_type="cDNA" r_start="16" r_stop="72" r_length="57" r_score="0.982"/>
        </exon>
        <intron i_serial="2">
          <gDNA_intron_boundary i_start="19488" i_stop="19398" i_length="91">
            <donor d_prob="0.972" d_score="0.98"/>
            <acceptor a_prob="0.812" a_score="0.98"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="3">
          <gDNA_exon_boundary g_start="19397" g_stop="19318" g_length="80"/>
          <reference_exon_boundary r_type="cDNA" r_start="73" r_stop="152" r_length="80" r_score="0.988"/>
        </exon>
        <intron i_serial="3">
          <gDNA_intron_boundary i_start="19317" i_stop="19231" i_length="87">
            <donor d_prob="0.431" d_score="0.98"/>
            <acceptor a_prob="0.994" a_score="1.00"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="4">
          <gDNA_exon_boundary g_start="19230" g_stop="19155" g_length="76"/>
          <reference_exon_boundary r_type="cDNA" r_start="153" r_stop="228" r_length="76" r_score="1.000"/>
        </exon>
        <intron i_serial="4">
          <gDNA_intron_boundary i_start="19154" i_stop="19012" i_length="143">
            <donor d_prob="0.994" d_score="1.00"/>
            <acceptor a_prob="0.980" a_score="1.00"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="5">
          <gDNA_exon_boundary g_start="19011" g_stop="18826" g_length="186"/>
          <reference_exon_boundary r_type="cDNA" r_start="229" r_stop="414" r_length="186" r_score="1.000"/>
        </exon>
        <intron i_serial="5">
          <gDNA_intron_boundary i_start="18825" i_stop="18741" i_length="85">
            <donor d_prob="0.993" d_score="1.00"/>
            <acceptor a_prob="0.997" a_score="0.98"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="6">
          <gDNA_exon_boundary g_start="18740" g_stop="18673" g_length="68"/>
          <reference_exon_boundary r_type="cDNA" r_start="415" r_stop="482" r_length="68" r_score="0.985"/>
        </exon>
        <intron i_serial="6">
          <gDNA_intron_boundary i_start="18672" i_stop="18578" i_length="95">
            <donor d_prob="0.392" d_score="0.98"/>
            <acceptor a_prob="0.931" a_score="0.00"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="7">
          <gDNA_exon_boundary g_start="18577" g_stop="18555" g_length="23"/>
          <reference_exon_boundary r_type="cDNA" r_start="483" r_stop="505" r_length="23" r_score="1.000"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C07HBa0073N22.1" gen_strand="-" ref_id="SGN-M1931" ref_strand="+">
        <total_alignment_score>0.994</total_alignment_score>
        <cumulative_length_of_scored_exons>505</cumulative_length_of_scored_exons>
        <coverage percentage="1.000" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C07HBa0073N22.1" gen_strand="-"/>
        <rDNA rDNA_id="SGN-M1931" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="19650" e_stop="19636"/>
          <exon e_start="19545" e_stop="19489"/>
          <exon e_start="19397" e_stop="19318"/>
          <exon e_start="19230" e_stop="19155"/>
          <exon e_start="19011" e_stop="18826"/>
          <exon e_start="18740" e_stop="18673"/>
          <exon e_start="18577" e_stop="18555"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>AGAAGTGATGAAACAGTAAGTGTTCAGACATTTACTATTAACTAAGTGAAGATAGAGTGTGACAGTTCTTCTTTATATGTGGCTAATCCTCTGTGCAAAAATTAGGTTGGAATGGTAGAGTCATATCTCCGTGCAAATAATATGTTTGTCGATTATAAAGAGGTATTTCCTGTCCTACCTCATTGCTCTAGTTTCAGTTTTCCAATTGAATCACTGTTACTTTCCCTTACACTTTGTTAAAAAATTGTTTCAGCCTCAACAAGAAAAGGTGTACTCTTCTTATTTGAACTTAGACCTTGCCGATGTTGAACCATGTCTGTCAGGGCCAAAGAGGTATTTTCCCGGATTGGACAAATTCTGATATAAGATGCAAAATGTGCTTAAGGTTGGTCTATATAAATGGTTTTTAATCCTCTACAGACCTCATGACCGTGTGCCTTTGAAAGAAATGAAGTCTGACTGGCATGCTTGCCTAGATAACAAAGTTGGATTCAAGGTGAGCGAGCTATTCATTTTGATATTTACCATTAGTTCTCTTGGTTGATCAACTTGTAACATAAATTGTTGTGAGACTAAATTACCCAACCCCAGATTCTGACTTCTGGAAATGCTAATCCAACTTGCTTTACATCGATTTAGGGATTTGCTGTGCCAAAAGAGGTGCAAGATAAAGTGGCCAAGTTTTCCTTCCATGGGCAACCTGCAGAGCTCAAACATGGCAGTGTTGTGATTGCTGCTATCACAAGTTGCACAAATACATCCAATCCCAGTGTTATGCTAGGAGCAGCTCTGGTTGCCAAAAAGGCATCTGAGCTGGGTCTACATGTTAGTGCTACTCCATATACTTGCCTTATCATTTGATTGTAATTCAGGCATGCCATCTTAATCCTTGTTCCTGATTATTTTTCAGGTTAAGCCATGGGTTAAAACTAGCCTTGCCCCAGGCTCTGGTGTTGTTACAAAATATTTACTCAAGAGGTATTGATTGGAAGTTTGTTAAAGAGCAAAGTTCTACTAACCCAGACCATTGTTACTTGAAAACATTGTGATATGTCATTTTCTGCATGTAACAGTGGTCTACAGAAGTATTTAAATC</genome_strand>
        <mrna_strand>AGAAGTGATGAAACA..........................................................................................GTTGGAATGGTAGAGTCATATCTCCGTGCAAATAATATGTTTGTTGATTATAAAGAG...........................................................................................CCTCAACAAGAAAAGGTGTACTCTTCTTATTTGAACCTAGACCTTGCCGATGTTGAACCATGTCTGTCAGGGCCAAAGAG.......................................................................................ACCTCATGACCGTGTGCCTTTGAAAGAAATGAAGTCTGACTGGCATGCTTGCCTAGATAACAAAGTTGGATTCAAG...............................................................................................................................................GGATTTGCTGTGCCAAAAGAGGTGCAAGATAAAGTGGCCAAGTTTTCCTTCCATGGGCAACCTGCAGAGCTCAAACATGGCAGTGTTGTGATTGCTGCTATCACAAGTTGCACAAATACATCCAATCCCAGTGTTATGCTAGGAGCAGCTCTGGTTGCCAAAAAGGCATCTGAGCTGGGTCTACAT.....................................................................................GTTAAGCCATGGGTTAAAACTAGCCTTGCCCCAAGCTCTGGTGTTGTTACAAAATATTTACTCAAGAG...............................................................................................TGGTCTACAGAAGTATTTAAATC</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
    <total_number_ESTs_reported>2</total_number_ESTs_reported>
    </alignment_module>
  <PGL_module xmlns="http://www.genomethreader.org/GTH_output/PGL_module/">
    <predicted_gene_location>
      <PGL_line PGL_serial="1" PGL_strand="+" PGL_start="6071" PGL_stop="6576"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="6071" e_stop="6576"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-only e_score="1.000"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="1.000">
            <gDNA_exon_boundary e_start="6071" e_stop="6576" e_length="506"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="6071" stop="6576"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="SGN-M444-F" strand="+"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="1" AGS_serial="1" gDNA_strand="+"/>
          <translation>
            <gDNA_template>GTCCTGAAAAGTTATCAAGGATTCATCAGTAACCTGATTATATCAACTCGTTTAAATTTATTCATACTTAATAGATCAACCCCTATGATCTCATTCTGACTATAAGCCTAAAGGTGAACAAGTGAGAAAAGGCCTAAATTATTTTTCTTCAAAATGTTGGTAATGTGATTACCTGATAATTTAGGCATCTTAGTGTACGTAAATGGCATGAATGGTGAAGGTGCTTGCAAAGGCAGCATAGCTTTGCTAGGAGTGATGTCTGGAGAGGCATGATTATGAGTTGTACTTAATAAATCACTCTCTTGAGATTTATGAATTCCTGAAACTGGAAAAAGGCTATGAGTGCATTTCATCAAGACAATTACGAATCAATTGAAATTGAAAATCACGTACAGAGAAGCAACACTATTGAGACTTGAATCATGAGACTCATTTCTTCAAATTTTGTTTACGTGTATAACCGAAAGATATATTTTGTGTGTAAATTGATTAAGCATAAGGTGTTT</gDNA_template>
            <first_frame> V  L  K  S  Y  Q  G  F  I  S  N  L  I  I  S  T  R  L  N  L  F  I  L  N  R  S  T  P  M  I  S  F  *  L  *  A  *  R  *  T  S  E  K  R  P  K  L  F  F  F  K  M  L  V  M  *  L  P  D  N  L  G  I  L  V  Y  V  N  G  M  N  G  E  G  A  C  K  G  S  I  A  L  L  G  V  M  S  G  E  A  *  L  *  V  V  L  N  K  S  L  S  *  D  L  *  I  P  E  T  G  K  R  L  *  V  H  F  I  K  T  I  T  N  Q  L  K  L  K  I  T  Y  R  E  A  T  L  L  R  L  E  S  *  D  S  F  L  Q  I  L  F  T  C  I  T  E  R  Y  I  L  C  V  N  *  L  S  I  R  C   </first_frame>
            <second_frame>  S  *  K  V  I  K  D  S  S  V  T  *  L  Y  Q  L  V  *  I  Y  S  Y  L  I  D  Q  P  L  *  S  H  S  D  Y  K  P  K  G  E  Q  V  R  K  G  L  N  Y  F  S  S  K  C  W  *  C  D  Y  L  I  I  *  A  S  *  C  T  *  M  A  *  M  V  K  V  L  A  K  A  A  *  L  C  *  E  *  C  L  E  R  H  D  Y  E  L  Y  L  I  N  H  S  L  E  I  Y  E  F  L  K  L  E  K  G  Y  E  C  I  S  S  R  Q  L  R  I  N  *  N  *  K  S  R  T  E  K  Q  H  Y  *  D  L  N  H  E  T  H  F  F  K  F  C  L  R  V  *  P  K  D  I  F  C  V  *  I  D  *  A  *  G  V  </second_frame>
            <third_frame>   P  E  K  L  S  R  I  H  Q  *  P  D  Y  I  N  S  F  K  F  I  H  T  *  *  I  N  P  Y  D  L  I  L  T  I  S  L  K  V  N  K  *  E  K  A  *  I  I  F  L  Q  N  V  G  N  V  I  T  *  *  F  R  H  L  S  V  R  K  W  H  E  W  *  R  C  L  Q  R  Q  H  S  F  A  R  S  D  V  W  R  G  M  I  M  S  C  T  *  *  I  T  L  L  R  F  M  N  S  *  N  W  K  K  A  M  S  A  F  H  Q  D  N  Y  E  S  I  E  I  E  N  H  V  Q  R  S  N  T  I  E  T  *  I  M  R  L  I  S  S  N  F  V  Y  V  Y  N  R  K  I  Y  F  V  C  K  L  I  K  H  K  V  F </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <none gDNA_id="C07HBa0073N22.1"/>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
    <predicted_gene_location>
      <PGL_line PGL_serial="2" PGL_strand="-" PGL_start="19650" PGL_stop="18555"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="19650" e_stop="19636"/>
            <exon e_start="19545" e_stop="19489"/>
            <exon e_start="19397" e_stop="19318"/>
            <exon e_start="19230" e_stop="19155"/>
            <exon e_start="19011" e_stop="18826"/>
            <exon e_start="18740" e_stop="18673"/>
            <exon e_start="18577" e_stop="18555"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-intron don_prob="0.461" acc_prob="0.894" e_score="1.000"/>
          <exon-intron don_prob="0.972" acc_prob="0.812" e_score="0.982"/>
          <exon-intron don_prob="0.431" acc_prob="0.994" e_score="0.988"/>
          <exon-intron don_prob="0.994" acc_prob="0.980" e_score="1.000"/>
          <exon-intron don_prob="0.993" acc_prob="0.997" e_score="1.000"/>
          <exon-intron don_prob="0.392" acc_prob="0.931" e_score="0.985"/>
          <exon-only e_score="1.000"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="1.000">
            <gDNA_exon_boundary e_start="19650" e_stop="19636" e_length="15"/>
          </exon>
          <intron i_serial="1" don_prob="0.461" acc_prob="0.894">
            <gDNA_intron_boundary i_start="19635" i_stop="19546" i_length="90"/>
          </intron>
          <exon e_serial="2" e_score="0.982">
            <gDNA_exon_boundary e_start="19545" e_stop="19489" e_length="57"/>
          </exon>
          <intron i_serial="2" don_prob="0.972" acc_prob="0.812">
            <gDNA_intron_boundary i_start="19488" i_stop="19398" i_length="91"/>
          </intron>
          <exon e_serial="3" e_score="0.988">
            <gDNA_exon_boundary e_start="19397" e_stop="19318" e_length="80"/>
          </exon>
          <intron i_serial="3" don_prob="0.431" acc_prob="0.994">
            <gDNA_intron_boundary i_start="19317" i_stop="19231" i_length="87"/>
          </intron>
          <exon e_serial="4" e_score="1.000">
            <gDNA_exon_boundary e_start="19230" e_stop="19155" e_length="76"/>
          </exon>
          <intron i_serial="4" don_prob="0.994" acc_prob="0.980">
            <gDNA_intron_boundary i_start="19154" i_stop="19012" i_length="143"/>
          </intron>
          <exon e_serial="5" e_score="1.000">
            <gDNA_exon_boundary e_start="19011" e_stop="18826" e_length="186"/>
          </exon>
          <intron i_serial="5" don_prob="0.993" acc_prob="0.997">
            <gDNA_intron_boundary i_start="18825" i_stop="18741" i_length="85"/>
          </intron>
          <exon e_serial="6" e_score="0.985">
            <gDNA_exon_boundary e_start="18740" e_stop="18673" e_length="68"/>
          </exon>
          <intron i_serial="6" don_prob="0.392" acc_prob="0.931">
            <gDNA_intron_boundary i_start="18672" i_stop="18578" i_length="95"/>
          </intron>
          <exon e_serial="7" e_score="1.000">
            <gDNA_exon_boundary e_start="18577" e_stop="18555" e_length="23"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="19650" stop="19636"/>
              <exon start="19545" stop="19489"/>
              <exon start="19397" stop="19318"/>
              <exon start="19230" stop="19155"/>
              <exon start="19011" stop="18826"/>
              <exon start="18740" stop="18673"/>
              <exon start="18577" stop="18555"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="SGN-M1931" strand="+"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="2" AGS_serial="1" gDNA_strand="-"/>
          <translation>
            <gDNA_template>AGAAGTGATGAAACA : GTTGGAATGGTAGAGTCATATCTCCGTGCAAATAATATGTTTGTCGATTATAAAGAG : CCTCAACAAGAAAAGGTGTACTCTTCTTATTTGAACTTAGACCTTGCCGATGTTGAACCATGTCTGTCAGGGCCAAAGAG : ACCTCATGACCGTGTGCCTTTGAAAGAAATGAAGTCTGACTGGCATGCTTGCCTAGATAACAAAGTTGGATTCAAG : GGATTTGCTGTGCCAAAAGAGGTGCAAGATAAAGTGGCCAAGTTTTCCTTCCATGGGCAACCTGCAGAGCTCAAACATGGCAGTGTTGTGATTGCTGCTATCACAAGTTGCACAAATACATCCAATCCCAGTGTTATGCTAGGAGCAGCTCTGGTTGCCAAAAAGGCATCTGAGCTGGGTCTACAT : GTTAAGCCATGGGTTAAAACTAGCCTTGCCCCAGGCTCTGGTGTTGTTACAAAATATTTACTCAAGAG : TGGTCTACAGAAGTATTTAAATC</gDNA_template>
            <first_frame> R  S  D  E  T  :  V  G  M  V  E  S  Y  L  R  A  N  N  M  F  V  D  Y  K  E  :  P  Q  Q  E  K  V  Y  S  S  Y  L  N  L  D  L  A  D  V  E  P  C  L  S  G  P  K  R :   P  H  D  R  V  P  L  K  E  M  K  S  D  W  H  A  C  L  D  N  K  V  G  F  K  :  G  F  A  V  P  K  E  V  Q  D  K  V  A  K  F  S  F  H  G  Q  P  A  E  L  K  H  G  S  V  V  I  A  A  I  T  S  C  T  N  T  S  N  P  S  V  M  L  G  A  A  L  V  A  K  K  A  S  E  L  G  L  H  :  V  K  P  W  V  K  T  S  L  A  P  G  S  G  V  V  T  K  Y  L  L  K  S :   G  L  Q  K  Y  L  N  </first_frame>
            <second_frame>  E  V  M  K  Q :   L  E  W  *  S  H  I  S  V  Q  I  I  C  L  S  I  I  K  S :   L  N  K  K  R  C  T  L  L  I  *  T  *  T  L  P  M  L  N  H  V  C  Q  G  Q  R   : D  L  M  T  V  C  L  *  K  K  *  S  L  T  G  M  L  A  *  I  T  K  L  D  S  R :   D  L  L  C  Q  K  R  C  K  I  K  W  P  S  F  P  S  M  G  N  L  Q  S  S  N  M  A  V  L  *  L  L  L  S  Q  V  A  Q  I  H  P  I  P  V  L  C  *  E  Q  L  W  L  P  K  R  H  L  S  W  V  Y  M :   L  S  H  G  L  K  L  A  L  P  Q  A  L  V  L  L  Q  N  I  Y  S  R   : V  V  Y  R  S  I  *  I </second_frame>
            <third_frame>   K  *  *  N   : S  W  N  G  R  V  I  S  P  C  K  *  Y  V  C  R  L  *  R   : A  S  T  R  K  G  V  L  F  L  F  E  L  R  P  C  R  C  *  T  M  S  V  R  A  K  E  :  T  S  *  P  C  A  F  E  R  N  E  V  *  L  A  C  L  P  R  *  Q  S  W  I  Q   : G  I  C  C  A  K  R  G  A  R  *  S  G  Q  V  F  L  P  W  A  T  C  R  A  Q  T  W  Q  C  C  D  C  C  Y  H  K  L  H  K  Y  I  Q  S  Q  C  Y  A  R  S  S  S  G  C  Q  K  G  I  *  A  G  S  T   : C  *  A  M  G  *  N  *  P  C  P  R  L  W  C  C  Y  K  I  F  T  Q  E  :  W  S  T  E  V  F  K   </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <orf_entry>
              <id_line>
                <gDNA id="C07HBa0073N22.1" strand="-"/>
                <serials PGL_serial="2" AGS_serial="1" PPS_serial="1"/>
                <orf_info>
                  <exon_boundaries>
                    <exon start="19650" stop="19636"/>
                    <exon start="19545" stop="19489"/>
                    <exon start="19397" stop="19318"/>
                    <exon start="19230" stop="19155"/>
                    <exon start="19011" stop="18826"/>
                    <exon start="18740" stop="18673"/>
                    <exon start="18577" stop="18556"/>
                  </exon_boundaries>
                  <frame>0</frame>
                  <number_coding_nucleotides>504</number_coding_nucleotides>
                  <number_encoded_amino_acids>168</number_encoded_amino_acids>
                </orf_info>
              </id_line>
              <predicted_protein_sequence>RSDETVGMVESYLRANNMFVDYKEPQQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKYLLKSGLQKYLN</predicted_protein_sequence>
            </orf_entry>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
  </PGL_module>
</GTH_output>
<!--
$ general statistics:
$ 2 chains have been computed
$ 
$ memory statistics:
$ 4320 bytes spliced alignments in total
$ 2 spliced alignments have been stored
$ 2160 bytes was the average size of a spliced alignment
$ 6896 bytes predicted gene locations in total
$ 2 predicted gene locations have been stored
$ 3448 bytes was the average size of a predicted gene location
$ 0 megabytes was the average size of the backtrace matrix
$ 2 backtrace matrices have been allocated
$ 
$ date finished: 2009-01-16 23:28:13
-->
