<?xml version="1.0" encoding="ISO-8859-1"?>
<GTH_output xmlns="http://www.genomethreader.org/GTH_output/" GTH_XML_version="1.1">
  <header xmlns="http://www.genomethreader.org/GTH_output/header/">
    <source program="GenomeThreader" version="0.9.54" build_date="2006-07-28 11:55:15" run_date="2007-12-13 17:43:43"/>
    <gDNA_template_files>
      <temp_name>/tmp/bac-submission-temp-uQN6V/GenomeThreader_SGN_E_tomato/un_xed_seqs</temp_name>
    </gDNA_template_files>
    <reference_files>
      <file ref_name="/tmp/cxgn-bacpublish-resources-9gHkMm/sgn_ests_tomato" type="ESTcDNA"/>
    </reference_files>
    <splice_site_parameters parameter_type="Bayesian" species="arabidopsis"/>
    <parameters>
      <parameter name="bssmfile" value="arabidopsis"/>
      <parameter name="scorematrixfile" value="BLOSUM62"/>
      <parameter name="searchmode" value="forward=True,reverse=True)"/>
      <parameter name="translationtable" value="1"/>
      <parameter name="frompos" value="0"/>
      <parameter name="topos" value="0"/>
      <parameter name="width" value="0"/>
      <parameter name="verbose" value="False"/>
      <parameter name="skipalignmentout" value="False"/>
      <parameter name="showintronmaxlen" value="120"/>
      <parameter name="minorflen" value="64"/>
      <parameter name="showseqnums" value="False"/>
      <parameter name="gs2out" value="False"/>
      <parameter name="maskpolyatails" value="False"/>
      <parameter name="noautoindex" value="False"/>
      <parameter name="minmatchlen" value="20"/>
      <parameter name="seedlength" value="16"/>
      <parameter name="exdrop" value="2"/>
      <parameter name="online" value="False"/>
      <parameter name="inverse" value="False"/>
      <parameter name="exact" value="False"/>
      <parameter name="chainwf" value="0.500000"/>
      <parameter name="gcmaxgapwidth" value="1000000"/>
      <parameter name="gcmincoverage" value="50"/>
      <parameter name="introncutout" value="False"/>
      <parameter name="autointroncutout" value="0"/>
      <parameter name="icinitialdelta" value="50"/>
      <parameter name="iciterations" value="2"/>
      <parameter name="icdeltaincrease" value="50"/>
      <parameter name="icminremintronlen" value="10"/>
      <parameter name="nou12intronmodel" value="False"/>
      <parameter name="u12donorprob" value="0.990000"/>
      <parameter name="u12donorprob1mism" value="0.900000"/>
      <parameter name="probies" value="0.500000"/>
      <parameter name="probdelgen" value="0.030000"/>
      <parameter name="identityweight" value="2.000000"/>
      <parameter name="mismatchweight" value="-2.000000"/>
      <parameter name="undetcharweight" value="0.000000"/>
      <parameter name="deletionweight" value="-4.000000"/>
      <parameter name="dpminexonlen" value="5"/>
      <parameter name="dpminintronlen" value="50"/>
      <parameter name="shortexonpenal" value="100"/>
      <parameter name="shortintronpenal" value="100"/>
      <parameter name="wzerotransition" value="80"/>
      <parameter name="wdecreasedoutput" value="80"/>
      <parameter name="leadcutoffsmode" value="RELAXED"/>
      <parameter name="termcutoffsmode" value="STRICT"/>
      <parameter name="cutoffsminexonlen" value="5"/>
      <parameter name="scoreminexonlen" value="50"/>
      <parameter name="minaveragessp" value="0.500000"/>
      <parameter name="minalignmentscore" value="0.900000"/>
      <parameter name="maxalignmentscore" value="1.000000"/>
      <parameter name="mincoverage" value="0.900000"/>
      <parameter name="maxcoverage" value="100.000000"/>
      <parameter name="intermediate" value="False"/>
      <parameter name="sortags" value="False"/>
      <parameter name="sortagswf" value="1.000000"/>
      <parameter name="first" value="0"/>
      <parameter name="exondistri" value="False"/>
      <parameter name="introndistri" value="False"/>
      <parameter name="refseqcovdistri" value="False"/>
    </parameters>
    <overall_reference_type>ESTcDNA</overall_reference_type>
  </header>
  <alignment_module>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/cxgn-bacpublish-resources-9gHkMm/sgn_ests_tomato" ref_id="SGN-E221519" ref_strand="-" ref_description="SGN-E221519 	[cLEL-10-F1]">
      <seq>ctcgaggcacactctatccgtttgtttgcaactttcttccttgtagcaatgctactgcttttatccactgagatgggaccaattagcagtgcagaggcaagaacttgtgagtcacagagcaacagtttcaaggggacatgtgttagggacagcaactgcgccaccgtttgccagactgaaggcttcatcggcggcaactgtcgtggcttccgtcgccgttgcttttgcaccagaaactgttagaacatatagagtttctacatgaaatactcatcatgcattcatgataaataatgatgttctattctatcaataaaaaagagagactagatatatatagtctcatatttatttatatataatatgtggttccgatcaaaaaaaaaaaaaaaaa</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-uQN6V/GenomeThreader_SGN_E_tomato/un_xed_seqs" temp_id="C07HBa0033O01.1" temp_strand="+" temp_description="C07HBa0033O01.1  AC212611.1 htgs_phase:3 submitted_to_sgn_as:gi|158262107|gb|AC212611.1| sequenced_by:ensat Solanum lycopersicum chromosome 7 clone C07HBa0033O01, complete sequence">
        <position start="476" stop="2456"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="777" g_stop="843" g_length="67"/>
          <reference_exon_boundary r_type="cDNA" r_start="5" r_stop="70" r_length="66" r_score="0.985"/>
        </exon>
        <intron i_serial="1">
          <gDNA_intron_boundary i_start="844" i_stop="1839" i_length="996">
            <donor d_prob="0.988" d_score="1.00"/>
            <acceptor a_prob="0.995" a_score="1.00"/>
          </gDNA_intron_boundary>
        </intron>
        <exon e_serial="2">
          <gDNA_exon_boundary g_start="1840" g_stop="2150" g_length="311"/>
          <reference_exon_boundary r_type="cDNA" r_start="71" r_stop="381" r_length="311" r_score="0.997"/>
        </exon>
      </exon-intron_info>
      <PPA_line polyA_start="382" polyA_stop="394"/>
      <MATCH_line gen_id="C07HBa0033O01.1" gen_strand="+" ref_id="SGN-E221519" ref_strand="-">
        <total_alignment_score>0.995</total_alignment_score>
        <cumulative_length_of_scored_exons>378</cumulative_length_of_scored_exons>
        <coverage percentage="0.959" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C07HBa0033O01.1" gen_strand="+"/>
        <rDNA rDNA_id="SGN-E221519" rDNA_strand="-"/>
        <gDNA_exon_coordinates>
          <exon e_start="777" e_stop="843"/>
          <exon e_start="1840" e_stop="2150"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>ATGGCACACTCTATCCGTTTGTTTGCAACTTTCTTCCTTGTAGCAATGCTACTGCTTTTATCCACTGGTTTGTCTTCTTTATTTATATTATTTAATTTTATTATATAGTTTTATAATATTAGCTCTACGTCAAAATTTAGCTCAATGAGAGAAAATTGTCCAATTTATGTTAAGAAGTCTTAGTCCTCTCATTCACCTTCAATGTGAGAGTATCCTTTTTTCATAACCCTCCACACACAAATCGAAACATAATTCTATACTGAAGTGTGAACAGTTTATTCGAAAACTCAATATCATATTTTTTAAAATTTTAATATCATGATGTATGAATTTTAGACTTGAGACAACCCAAAATTAGTTCAAAGTACAATAACAAAAGAGACATTATCCAAACACAATATGATATTGTAGCATGAACACCCGATATCATATGATTTGATTCTAATATCATGATATATGAATTTTGGACTTAACAAAACCCAAAAATAGCTCAAAACACTATAACAAAAGAGACATTACCCAAACACGATCTGACACTGAGGCATGAACATTCGATAATCCGTTATCATATGTTTTGATTCTAATATCATGATATATATGAATTTTGGACTTGACACAATCAAAAATCAGCTCAAGGCACTATAACAAAAGAGACGTTATCTAAACACAATTTGCTACTGAAGCATGAACACCCCAAATTTGGGACTCAACACAACCCAAAATTAGCTCAAGGCACTATGTTTTGATTCTAATATCATGATATATGAATTTCGGACTCAACACAATTCAAAATTAGCTCAAGGCACTATAACAAAAGAGACATTACTCAAACACGAGCCGATACTGAAGCATGAACAATTCTACAATTCTAGACATTACCCAAACACGATCCGATACTGAAGCATGAACAATTCTAGACATTACCCAAACACGATCCAATACTGAAGCACGAACAATTCTTGTTGCTATACAATTATATTAAATATATCCTAGTTATCTTATCCACGACCGATGTGGGAGTCTTGTTTCATCATTCATAACATGTTTGGCTAAAATTGAACAGAGATGGGACCAATTAGCAGTGCAGAGGCAAGAACTTGTGAGTCACAGAGCAACAGTTTCAAGGGGACATGTGTTAGGGACAGCAACTGCGCCACCGTTTGCCAGACTGAAGGCTTCATCGGCGGCAACTGTCGTGGCTTCCGTCGCCGTTGCTTTTGCACCAGAAACTGTTAGAACATATAGAGTTTCTACATGAAATACTCATCATGCATTCATGATAAATAATGATGTTCTATTCTATCAATAAAAAAGAGAGACTAGATATATATAGTCTCATATTTATTTATATATAATATGTGGTTACGATCAAAA</genome_strand>
        <mrna_strand>A-GGCACACTCTATCCGTTTGTTTGCAACTTTCTTCCTTGTAGCAATGCTACTGCTTTTATCCACTG....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AGATGGGACCAATTAGCAGTGCAGAGGCAAGAACTTGTGAGTCACAGAGCAACAGTTTCAAGGGGACATGTGTTAGGGACAGCAACTGCGCCACCGTTTGCCAGACTGAAGGCTTCATCGGCGGCAACTGTCGTGGCTTCCGTCGCCGTTGCTTTTGCACCAGAAACTGTTAGAACATATAGAGTTTCTACATGAAATACTCATCATGCATTCATGATAAATAATGATGTTCTATTCTATCAATAAAAAAGAGAGACTAGATATATATAGTCTCATATTTATTTATATATAATATGTGGTTCCGATCAAAA</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/cxgn-bacpublish-resources-9gHkMm/sgn_ests_tomato" ref_id="SGN-E222276" ref_strand="+" ref_description="SGN-E222276 	[cLEL-16-G4]">
      <seq>tttttttttttttttttaaactaataaaaacagatactagattagccaatcatgacctatgatttttgatcgtaaccacatattatatataaataaatatgagactatatatatctagtctctcttttttattgatagaatagaacatcattatttatcatgaatgcatgatgagtatttcatgtagaaactctatatgttctaacagtttctggtgcaaaagcaacggcgacggaagccacgacagttgccgccgatgaagccttcagtctggcaaacggtggcgcagttgctgtccctaacacatgtccccttgaaactgttg</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-uQN6V/GenomeThreader_SGN_E_tomato/un_xed_seqs" temp_id="C07HBa0033O01.1" temp_strand="-" temp_description="C07HBa0033O01.1  AC212611.1 htgs_phase:3 submitted_to_sgn_as:gi|158262107|gb|AC212611.1| sequenced_by:ensat Solanum lycopersicum chromosome 7 clone C07HBa0033O01, complete sequence">
        <position start="2500" stop="1589"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="2213" g_stop="1889" g_length="325"/>
          <reference_exon_boundary r_type="cDNA" r_start="1" r_stop="325" r_length="325" r_score="0.969"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C07HBa0033O01.1" gen_strand="-" ref_id="SGN-E222276" ref_strand="+">
        <total_alignment_score>0.969</total_alignment_score>
        <cumulative_length_of_scored_exons>325</cumulative_length_of_scored_exons>
        <coverage percentage="1.000" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C07HBa0033O01.1" gen_strand="-"/>
        <rDNA rDNA_id="SGN-E222276" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="2213" e_stop="1889"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>TCGATGATTCACATATTAAACTAATAAAAACAGATACTAGATTAGCCAATCATGACCTATGATTTTTGATCGTAACCACATATTATATATAAATAAATATGAGACTATATATATCTAGTCTCTCTTTTTTATTGATAGAATAGAACATCATTATTTATCATGAATGCATGATGAGTATTTCATGTAGAAACTCTATATGTTCTAACAGTTTCTGGTGCAAAAGCAACGGCGACGGAAGCCACGACAGTTGCCGCCGATGAAGCCTTCAGTCTGGCAAACGGTGGCGCAGTTGCTGTCCCTAACACATGTCCCCTTGAAACTGTTG</genome_strand>
        <mrna_strand>TTTTTTTTTTTTTTTTTAAACTAATAAAAACAGATACTAGATTAGCCAATCATGACCTATGATTTTTGATCGTAACCACATATTATATATAAATAAATATGAGACTATATATATCTAGTCTCTCTTTTTTATTGATAGAATAGAACATCATTATTTATCATGAATGCATGATGAGTATTTCATGTAGAAACTCTATATGTTCTAACAGTTTCTGGTGCAAAAGCAACGGCGACGGAAGCCACGACAGTTGCCGCCGATGAAGCCTTCAGTCTGGCAAACGGTGGCGCAGTTGCTGTCCCTAACACATGTCCCCTTGAAACTGTTG</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
  <spliced_alignment xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
    <reference ref_file="/tmp/cxgn-bacpublish-resources-9gHkMm/sgn_ests_tomato" ref_id="SGN-E277864" ref_strand="+" ref_description="SGN-E277864 	[cLEL-5-O8]">
      <seq>gcacgaggacgccggcgccgtcaccgttacctcgccggaaaataaatatacatacaagtataacaagtgataaaagactacagcgtgaactatccggtatcttgagccttgaggaacttgaaggtagtaaaagtgaccaaattttcaggtggaagaagcttaataaacggtctgatgagctgatccagtgttcttcaaccgaaaatctctgcaactaataccaatggaagcatcgccaattctggtatattcaaagctaccatcctcgttcggatgtaatgtatcaaaacataacactttttcttacagaccttctcacaaaca</seq>
    </reference>
    <gDNA_segment>
      <template temp_file="/tmp/bac-submission-temp-uQN6V/GenomeThreader_SGN_E_tomato/un_xed_seqs" temp_id="C07HBa0033O01.1" temp_strand="-" temp_description="C07HBa0033O01.1  AC212611.1 htgs_phase:3 submitted_to_sgn_as:gi|158262107|gb|AC212611.1| sequenced_by:ensat Solanum lycopersicum chromosome 7 clone C07HBa0033O01, complete sequence">
        <position start="21126" stop="20211"/>
      </template>
    </gDNA_segment>
    <predicted_gene_structure xmlns="http://www.genomethreader.org/GTH_output/alignment_module/spliced_alignment/">
      <exon-intron_info>
        <exon e_serial="1">
          <gDNA_exon_boundary g_start="20833" g_stop="20511" g_length="323"/>
          <reference_exon_boundary r_type="cDNA" r_start="1" r_stop="324" r_length="324" r_score="0.969"/>
        </exon>
      </exon-intron_info>
      <MATCH_line gen_id="C07HBa0033O01.1" gen_strand="-" ref_id="SGN-E277864" ref_strand="+">
        <total_alignment_score>0.969</total_alignment_score>
        <cumulative_length_of_scored_exons>323</cumulative_length_of_scored_exons>
        <coverage percentage="0.997" high_type="C"/>
      </MATCH_line>
      <PGS_line>
        <gDNA gen_id="C07HBa0033O01.1" gen_strand="-"/>
        <rDNA rDNA_id="SGN-E277864" rDNA_strand="+"/>
        <gDNA_exon_coordinates>
          <exon e_start="20833" e_stop="20511"/>
        </gDNA_exon_coordinates>
      </PGS_line>
      <alignment>
        <genome_strand>TTAGCTCGACGCCGGCGCCGTCACCGTTACCTCGCCGGAAAATAAATATACATACAAGTATAACAAGTGATAAAAGACTA-AGCGTGAACTATCCGGTATCTTGAGCCTTGAGGAACTTGAAGGTAGTAAAAGTGACCAAATTTTCAGGTGGAAGAAGCTTAATAAACGGTCTGATGAGCTGATCCAGTGTTCTTCAACCGAAAATCTCTGCAACTAATACCAATGGAAGCATCGCCAATTCTGGTATATTCAAAGCTACCATCCTCGTTCGGATGTAATGTATCAAAACAAAACACTTTTTCTTACAGACCTTCCCACAAACA</genome_strand>
        <mrna_strand>GCACGAGGACGCCGGCGCCGTCACCGTTACCTCGCCGGAAAATAAATATACATACAAGTATAACAAGTGATAAAAGACTACAGCGTGAACTATCCGGTATCTTGAGCCTTGAGGAACTTGAAGGTAGTAAAAGTGACCAAATTTTCAGGTGGAAGAAGCTTAATAAACGGTCTGATGAGCTGATCCAGTGTTCTTCAACCGAAAATCTCTGCAACTAATACCAATGGAAGCATCGCCAATTCTGGTATATTCAAAGCTACCATCCTCGTTCGGATGTAATGTATCAAAACATAACACTTTTTCTTACAGACCTTCTCACAAACA</mrna_strand>
      </alignment>
    </predicted_gene_structure>
  </spliced_alignment>
    <total_number_ESTs_reported>3</total_number_ESTs_reported>
    </alignment_module>
  <PGL_module xmlns="http://www.genomethreader.org/GTH_output/PGL_module/">
    <predicted_gene_location>
      <PGL_line PGL_serial="1" PGL_strand="+" PGL_start="777" PGL_stop="2150"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="777" e_stop="843"/>
            <exon e_start="1840" e_stop="2150"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-intron don_prob="0.988" acc_prob="0.995" e_score="0.985"/>
          <exon-only e_score="0.997"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="0.985">
            <gDNA_exon_boundary e_start="777" e_stop="843" e_length="67"/>
          </exon>
          <intron i_serial="1" don_prob="0.988" acc_prob="0.995">
            <gDNA_intron_boundary i_start="844" i_stop="1839" i_length="996"/>
          </intron>
          <exon e_serial="2" e_score="0.997">
            <gDNA_exon_boundary e_start="1840" e_stop="2150" e_length="311"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="777" stop="843"/>
              <exon start="1840" stop="2150"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="SGN-E221519" strand="-"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="1" AGS_serial="1" gDNA_strand="+"/>
          <translation>
            <gDNA_template>ATGGCACACTCTATCCGTTTGTTTGCAACTTTCTTCCTTGTAGCAATGCTACTGCTTTTATCCACTG : AGATGGGACCAATTAGCAGTGCAGAGGCAAGAACTTGTGAGTCACAGAGCAACAGTTTCAAGGGGACATGTGTTAGGGACAGCAACTGCGCCACCGTTTGCCAGACTGAAGGCTTCATCGGCGGCAACTGTCGTGGCTTCCGTCGCCGTTGCTTTTGCACCAGAAACTGTTAGAACATATAGAGTTTCTACATGAAATACTCATCATGCATTCATGATAAATAATGATGTTCTATTCTATCAATAAAAAAGAGAGACTAGATATATATAGTCTCATATTTATTTATATATAATATGTGGTTACGATCAAAA</gDNA_template>
            <first_frame> M  A  H  S  I  R  L  F  A  T  F  F  L  V  A  M  L  L  L  L  S  T   : E  M  G  P  I  S  S  A  E  A  R  T  C  E  S  Q  S  N  S  F  K  G  T  C  V  R  D  S  N  C  A  T  V  C  Q  T  E  G  F  I  G  G  N  C  R  G  F  R  R  R  C  F  C  T  R  N  C  *  N  I  *  S  F  Y  M  K  Y  S  S  C  I  H  D  K  *  *  C  S  I  L  S  I  K  K  R  D  *  I  Y  I  V  S  Y  L  F  I  Y  N  M  W  L  R  S  K </first_frame>
            <second_frame>  W  H  T  L  S  V  C  L  Q  L  S  S  L  *  Q  C  Y  C  F  Y  P  L  :  R  W  D  Q  L  A  V  Q  R  Q  E  L  V  S  H  R  A  T  V  S  R  G  H  V  L  G  T  A  T  A  P  P  F  A  R  L  K  A  S  S  A  A  T  V  V  A  S  V  A  V  A  F  A  P  E  T  V  R  T  Y  R  V  S  T  *  N  T  H  H  A  F  M  I  N  N  D  V  L  F  Y  Q  *  K  R  E  T  R  Y  I  *  S  H  I  Y  L  Y  I  I  C  G  Y  D  Q   </second_frame>
            <third_frame>   G  T  L  Y  P  F  V  C  N  F  L  P  C  S  N  A  T  A  F  I  H  * :   D  G  T  N  *  Q  C  R  G  K  N  L  *  V  T  E  Q  Q  F  Q  G  D  M  C  *  G  Q  Q  L  R  H  R  L  P  D  *  R  L  H  R  R  Q  L  S  W  L  P  S  P  L  L  L  H  Q  K  L  L  E  H  I  E  F  L  H  E  I  L  I  M  H  S  *  *  I  M  M  F  Y  S  I  N  K  K  E  R  L  D  I  Y  S  L  I  F  I  Y  I  *  Y  V  V  T  I  K  </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <orf_entry>
              <id_line>
                <gDNA id="C07HBa0033O01.1" strand="+"/>
                <serials PGL_serial="1" AGS_serial="1" PPS_serial="1"/>
                <orf_info>
                  <exon_boundaries>
                    <exon start="777" stop="843"/>
                    <exon start="1840" stop="2012"/>
                  </exon_boundaries>
                  <frame>0</frame>
                  <number_coding_nucleotides>237</number_coding_nucleotides>
                  <number_encoded_amino_acids>79</number_encoded_amino_acids>
                </orf_info>
              </id_line>
              <predicted_protein_sequence>MAHSIRLFATFFLVAMLLLLSTEMGPISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC*</predicted_protein_sequence>
            </orf_entry>
            <orf_entry>
              <id_line>
                <gDNA id="C07HBa0033O01.1" strand="+"/>
                <serials PGL_serial="1" AGS_serial="1" PPS_serial="2"/>
                <orf_info>
                  <exon_boundaries>
                    <exon start="820" stop="843"/>
                    <exon start="1840" stop="2034"/>
                  </exon_boundaries>
                  <frame>1</frame>
                  <number_coding_nucleotides>216</number_coding_nucleotides>
                  <number_encoded_amino_acids>72</number_encoded_amino_acids>
                </orf_info>
              </id_line>
              <predicted_protein_sequence>QCYCFYPLRWDQLAVQRQELVSHRATVSRGHVLGTATAPPFARLKASSAATVVASVAVAFAPETVRTYRVST*</predicted_protein_sequence>
            </orf_entry>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
    <predicted_gene_location>
      <PGL_line PGL_serial="2" PGL_strand="-" PGL_start="2213" PGL_stop="1889"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="2213" e_stop="1889"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-only e_score="0.969"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="0.969">
            <gDNA_exon_boundary e_start="2213" e_stop="1889" e_length="325"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="2213" stop="1889"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="SGN-E222276" strand="+"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="2" AGS_serial="1" gDNA_strand="-"/>
          <translation>
            <gDNA_template>TCGATGATTCACATATTAAACTAATAAAAACAGATACTAGATTAGCCAATCATGACCTATGATTTTTGATCGTAACCACATATTATATATAAATAAATATGAGACTATATATATCTAGTCTCTCTTTTTTATTGATAGAATAGAACATCATTATTTATCATGAATGCATGATGAGTATTTCATGTAGAAACTCTATATGTTCTAACAGTTTCTGGTGCAAAAGCAACGGCGACGGAAGCCACGACAGTTGCCGCCGATGAAGCCTTCAGTCTGGCAAACGGTGGCGCAGTTGCTGTCCCTAACACATGTCCCCTTGAAACTGTTG</gDNA_template>
            <first_frame> S  M  I  H  I  L  N  *  *  K  Q  I  L  D  *  P  I  M  T  Y  D  F  *  S  *  P  H  I  I  Y  K  *  I  *  D  Y  I  Y  L  V  S  L  F  Y  *  *  N  R  T  S  L  F  I  M  N  A  *  *  V  F  H  V  E  T  L  Y  V  L  T  V  S  G  A  K  A  T  A  T  E  A  T  T  V  A  A  D  E  A  F  S  L  A  N  G  G  A  V  A  V  P  N  T  C  P  L  E  T  V  </first_frame>
            <second_frame>  R  *  F  T  Y  *  T  N  K  N  R  Y  *  I  S  Q  S  *  P  M  I  F  D  R  N  H  I  L  Y  I  N  K  Y  E  T  I  Y  I  *  S  L  F  F  I  D  R  I  E  H  H  Y  L  S  *  M  H  D  E  Y  F  M  *  K  L  Y  M  F  *  Q  F  L  V  Q  K  Q  R  R  R  K  P  R  Q  L  P  P  M  K  P  S  V  W  Q  T  V  A  Q  L  L  S  L  T  H  V  P  L  K  L  L </second_frame>
            <third_frame>   D  D  S  H  I  K  L  I  K  T  D  T  R  L  A  N  H  D  L  *  F  L  I  V  T  T  Y  Y  I  *  I  N  M  R  L  Y  I  S  S  L  S  F  L  L  I  E  *  N  I  I  I  Y  H  E  C  M  M  S  I  S  C  R  N  S  I  C  S  N  S  F  W  C  K  S  N  G  D  G  S  H  D  S  C  R  R  *  S  L  Q  S  G  K  R  W  R  S  C  C  P  *  H  M  S  P  *  N  C   </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <none gDNA_id="C07HBa0033O01.1"/>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
    <predicted_gene_location>
      <PGL_line PGL_serial="3" PGL_strand="-" PGL_start="20833" PGL_stop="20511"/>
      <AGS_information>
        <AGS_line AGS_serial="1">
          <exon_coordinates>
            <exon e_start="20833" e_stop="20511"/>
          </exon_coordinates>
        </AGS_line>
        <SCR_line>
          <exon-only e_score="0.969"/>
        </SCR_line>
        <exon-intron_info xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/exon-intron_info/">
          <exon e_serial="1" e_score="0.969">
            <gDNA_exon_boundary e_start="20833" e_stop="20511" e_length="323"/>
          </exon>
        </exon-intron_info>
        <supporting_evidence xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/supporting_evidence/">
          <PGS_line>
            <gDNA_exon_coordinates>
              <exon start="20833" stop="20511"/>
            </gDNA_exon_coordinates>
            <referenceDNA id="SGN-E277864" strand="+"/>
          </PGS_line>
        </supporting_evidence>
        <three_phase_translation xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/">
          <description PGL_serial="3" AGS_serial="1" gDNA_strand="-"/>
          <translation>
            <gDNA_template>TTAGCTCGACGCCGGCGCCGTCACCGTTACCTCGCCGGAAAATAAATATACATACAAGTATAACAAGTGATAAAAGACTAAGCGTGAACTATCCGGTATCTTGAGCCTTGAGGAACTTGAAGGTAGTAAAAGTGACCAAATTTTCAGGTGGAAGAAGCTTAATAAACGGTCTGATGAGCTGATCCAGTGTTCTTCAACCGAAAATCTCTGCAACTAATACCAATGGAAGCATCGCCAATTCTGGTATATTCAAAGCTACCATCCTCGTTCGGATGTAATGTATCAAAACAAAACACTTTTTCTTACAGACCTTCCCACAAACA</gDNA_template>
            <first_frame> L  A  R  R  R  R  R  H  R  Y  L  A  G  K  *  I  Y  I  Q  V  *  Q  V  I  K  D  *  A  *  T  I  R  Y  L  E  P  *  G  T  *  R  *  *  K  *  P  N  F  Q  V  E  E  A  *  *  T  V  *  *  A  D  P  V  F  F  N  R  K  S  L  Q  L  I  P  M  E  A  S  P  I  L  V  Y  S  K  L  P  S  S  F  G  C  N  V  S  K  Q  N  T  F  S  Y  R  P  S  H  K   </first_frame>
            <second_frame>  *  L  D  A  G  A  V  T  V  T  S  P  E  N  K  Y  T  Y  K  Y  N  K  *  *  K  T  K  R  E  L  S  G  I  L  S  L  E  E  L  E  G  S  K  S  D  Q  I  F  R  W  K  K  L  N  K  R  S  D  E  L  I  Q  C  S  S  T  E  N  L  C  N  *  Y  Q  W  K  H  R  Q  F  W  Y  I  Q  S  Y  H  P  R  S  D  V  M  Y  Q  N  K  T  L  F  L  T  D  L  P  T  N  </second_frame>
            <third_frame>   S  S  T  P  A  P  S  P  L  P  R  R  K  I  N  I  H  T  S  I  T  S  D  K  R  L  S  V  N  Y  P  V  S  *  A  L  R  N  L  K  V  V  K  V  T  K  F  S  G  G  R  S  L  I  N  G  L  M  S  *  S  S  V  L  Q  P  K  I  S  A  T  N  T  N  G  S  I  A  N  S  G  I  F  K  A  T  I  L  V  R  M  *  C  I  K  T  K  H  F  F  L  Q  T  F  P  Q  T </third_frame>
          </translation>
          <probable_ORFs xmlns="http://www.genomethreader.org/GTH_output/PGL_module/predicted_gene_location/AGS_information/three_phase_translation/probable_ORFs/">
            <none gDNA_id="C07HBa0033O01.1"/>
          </probable_ORFs>
        </three_phase_translation>
      </AGS_information>
    </predicted_gene_location>
  </PGL_module>
</GTH_output>
<!--
$ general statistics:
$ 6 chains have been computed
$ 
$ memory statistics:
$ 5336 bytes spliced alignments in total
$ 3 spliced alignments have been stored
$ 1778 bytes was the average size of a spliced alignment
$ 7912 bytes predicted gene locations in total
$ 3 predicted gene locations have been stored
$ 2637 bytes was the average size of a predicted gene location
$ 0 megabytes was the average size of the backtrace matrix
$ 9 backtrace matrices have been allocated
$ 
$ date finished: 2007-12-13 17:44:26
-->
