FGENESH 2.4 Prediction of potential genes in Tomato genomic DNA
 Time    :   Thu Dec 13 08:06:33 2007
 Seq name: C08SLe0028E18.1 AP009413.1 htgs_phase:3 submitted_to_sgn_as:C08SLe0028E18 sequenced_by:kazusa 
 Length of sequence: 8019 
 Number of predicted genes 1 in +chain 0 in -chain 1
 Number of predicted exons 2 in +chain 0 in -chain 2
 Positions of predicted genes and exons: Variant   1 from   1, Score:21.879956 
   G Str   Feature   Start        End    Score           ORF           Len

   1 -      PolA      1235               -0.59
   1 -    1 CDSl      1428 -      1434   -6.06      1428 -      1433      6
   1 -    2 CDSf      1491 -      1855   29.42      1493 -      1855    363

Predicted protein(s):
>FGENESH:   1   2 exon (s)   1428  -   1855   123 aa, chain -
MSVKLYFELKKNEPGFSIYPLCIDTIEKNSGTVHNFDGRSGEITCVEGTTNDTQALAIVE
NSLFETHENSEVGVANDIINSDIVDVKTGQIYKDKATLVDVMTKYKIKNNFNCKVKRSDQ
QST