##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C08HBa0202N15-AxHDA/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C08HBa0202N15-AxHDA/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 140561, name = C08HBa0202N15.1) ----- # # Set orientation to forward for hint group HintGroup SGN-U319604, 15895-17724, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U317987, 28108-30513, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U342577, 34794-38133, priority= 4 9 features # Set orientation to forward for hint group HintGroup SGN-U313358, 39516-42495, priority= 4 13 features # Set orientation to forward for hint group HintGroup SGN-U334299, 41696-42444, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U318012, 51585-54064, priority= 4 15 features # Set orientation to forward for hint group HintGroup SGN-U321921, 56642-61343, priority= 4 5 features # Delete group HintGroup SGN-U319112, 70933-118840, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U328568, 96090-97018, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U322962, 99353-103684, priority= 4 23 features # Set orientation to forward for hint group HintGroup SGN-U326130, 104315-106779, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U322961, 116947-123031, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U320351, 123504-125534, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U321772, 125983-129165, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U321713, 130738-132702, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U313699, 139464-140550, priority= 4 5 features # Forced unstranded hint group to the only possible strand for 15 groups. # Deleted 1 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 18330 19082 1 - . ID=g1 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 18330 19082 . - . ID=g1.t1;Parent=g1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 18330 18332 . - 0 Parent=g1.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 18330 19082 . - 0 ID=g1.t1.cds;Parent=g1.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 19080 19082 . - 0 Parent=g1.t1 # protein sequence = [MASASSFQLSSLQIQTPPLKKSNFLGQSVNLNLSSSVHTKSAMKSSSNSVTPIAKFNLYEILGGRGLCNGEEGIEKEL # KKSISEEQKAVGSAAAAASDDDNQENKETGEIPEDGFEKEMMGFTGGFPGGEKGLMKFIEKNPPPPPPKKTESSMVSGFNQSLVKKPKPPELPLLLPG # MIAIVKNSNNPYYMYCGIVQRITDGKAAVLFEGGNWDRLISFRLEELERREKGPPMVNLKSVILEKMVEKSSEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U313087) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 22868 37945 1 + . ID=g2 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 22868 37945 . + . ID=g2.t1;Parent=g2 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 22868 22870 . + 0 Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 22868 23561 . + 0 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 24830 25703 . + 2 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 27594 28989 . + 1 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 29071 29154 . + 0 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 29653 30339 . + 0 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 34739 34821 . + 0 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 35761 35824 . + 1 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 35918 36038 . + 0 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 37205 37359 . + 2 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 37862 37945 . + 0 ID=g2.t1.cds;Parent=g2.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 37943 37945 . + 0 Parent=g2.t1 # protein sequence = [MPRSSKHKSHKQSKYSPKECRDYSYSDSDSEVKTKEKEKERSSKEDSLARVSKDSIHSGSGEKRKHSSQSKEGKDGKD # LSGYGNGDASEEYVSSKRRKEKVEVGSGGADRWNGAADNALKGESLKIDADKGSKGKETKSSSDSKSKSSKKEGNVASLVEKEESKSGRVESKRKSEK # DSGRKEGKDSKEVKEKERGSDREKKGHESKRDDADNVKKQGSQSGDVTEEKQNKKEWSIQNEAPNVDLDKDAEKRARKRREIPGDRDKYDDDINEGDE # RRLSSRSERTKGEKQRHEKHKEYKEDVDKDDRHKDDRYREDVDKDRKRRDDKYREDSDRDNRRRDDKYLEDVDRDSRRRDDKYRDDGDRDNRRKDGRY # REDDERDSRRRDDKYREDGDNDNRHGDDKYREYGEKDGHHDEDRYHEEGERDDRQRDIKYREDSERDKRRKDEKHRDDFERHGRCKDVSEADESDKKR # RLNDAKYGDERAPRDHSGDRTDAKRSRDEGHASDLHLRRSGMHEGNPGYDRARLSKQEESKYRDYPYEERIRHGGASRDYAGSAASIERISSSRSTEK # MIQKEDIFLGDHSAERRLKSDVRSSPMHLVDRSPTSASNERRHLNRSDVRRSLDVEDSTQRSGGGSREVKEGRGNRDFAGDAFAGDELSQMDGDNASD # SSPFIRGSHLSGSSKSALPPPPPFRSGVDSPSMFGSLDDDSRGKSTNRHRRINDPTIGRMQGNAWKGVPNWPSPLANGFMPFQHGPPPVGFHPAMQQF # PGPPMFGVRPSMDLSHPGVPYHMPDADRFSGHGRPMGWRTPLDDSCGPPLHGWDANNFGEEAHLYGRPDWDQNRTLSNNSRSWETIGDVWKGPIRGTS # VEVPSGSQKEVCSIQGPDNSFASQLAQQALGEQKQTDQDAESNNISFQSSSVPGRNTLEDLKINHEEQPIDVKSSGKGEASLNNVYLKKLDISADLTE # PELFDRCTSLMDVEQILTSDNSKILFLEGAVESNVVLPSKFSTVPLIATVADSVFQKAISLYKRREKIEFTNGGHFTFSGQLGVSSPAPKLENSSSVH # GKLECSGLVDDALVEEGDEGTDLLVSSISSEEVVLSQTTLQELCEPMGLNPGEKSDLPSSLDEGAVPTEKSDFPTTMDEGAVPIEKPDLPTSMDEGAV # LSEKSDLPTSMDEGAGPSEKSDLPTSMDEGAGMEADTVVDVAQEIKVLETAEEVGQTDALASLVSKDLMGADDVDAKCDALPHTDVSTEVVLTAVEVE # SLRSEIAALEEREAHLKAQLEHIDEILQSARMSGYLYLRTRWEALPGEPLPIDDDTEVDDWLPKFLVLQGSGIFLYSSSIDLSPQDSTLLSDVVEVGA # MPCLTRDNGDTRYCFFISTRHGLRYECSSASKIQVDSWLASLPNHSDLQSNCTAPDELTNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 68.4 # CDS exons: 7/10 # E: 7 # CDS introns: 6/9 # E: 6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U317987,SGN-U342577) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 39557 42233 1 + . ID=g3 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 39557 42233 . + . ID=g3.t1;Parent=g3 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 39557 39559 . + 0 Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 39557 39644 . + 0 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 40807 40941 . + 2 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 41258 41295 . + 2 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 41403 41453 . + 0 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 41642 41809 . + 0 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 41901 42013 . + 0 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 42110 42233 . + 1 ID=g3.t1.cds;Parent=g3.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 42231 42233 . + 0 Parent=g3.t1 # protein sequence = [MNSQICRSATRAAKSLLSASSKQTSRAFSGGRAAAAAATVSLRGVVPSLASYGRNESGNASRAWISGVLALPAAAYML # QEQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLVAIKVVIPSKEFAKKHYHDLSERPFFNGLCDFLSSGPVLAMVWEGEGVIRYGRKLIG # ATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWFKPEELVNYTSNSEKWLYGDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 7/7 # E: 7 # CDS introns: 6/6 # E: 6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U313358,SGN-U334299) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 44220 53712 1 + . ID=g4 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 44220 53712 . + . ID=g4.t1;Parent=g4 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 44220 44222 . + 0 Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 44220 44222 . + 0 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 51554 51603 . + 0 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 51859 51994 . + 1 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 52076 52177 . + 0 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 52284 52511 . + 0 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 52715 52793 . + 0 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 52907 52989 . + 2 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 53395 53486 . + 0 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 53610 53712 . + 1 ID=g4.t1.cds;Parent=g4.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 53710 53712 . + 0 Parent=g4.t1 # protein sequence = [MVDLRDKPAIEEIFRSNKFDAVIHFAGLKAVGESVEKPLMYYDNNLIGTITLLEVMAAHGCKKLVFSSSATVYGWPKV # VPCTEEFPLSAANPYGRTKLFIEEICRDVQNADSEWKIILLRYFNPVGAHPSGRIGEDPRGIPNNLMPFVQQVAVGRRKELTVYGTDYGTKDGTGVRD # YIHVIDLADGHIAALQKLSDPSIGCEVYNLGTGKGTSVLEMVAAFEKASGKKIPMVMSGRRPGDAEIVYAATEKAERELKWKAKYGIEEMCRDQWNWA # KKNPYGYEGTPESNNCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 88.2 # CDS exons: 8/9 # E: 8 # CDS introns: 7/8 # E: 7 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U333206,SGN-U318012) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 56839 61032 1 + . ID=g5 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 56839 61032 . + . ID=g5.t1;Parent=g5 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 56839 56841 . + 0 Parent=g5.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 56839 56874 . + 0 ID=g5.t1.cds;Parent=g5.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 58643 58725 . + 0 ID=g5.t1.cds;Parent=g5.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 60060 61032 . + 1 ID=g5.t1.cds;Parent=g5.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 61030 61032 . + 0 Parent=g5.t1 # protein sequence = [MATSNDIVAATKGQEELSVLISEREIFDQCGPVHLTAIDWENVAHQRSVAASLVQGVYILERDKQEKRKGSQALAPPW # WRHFQFELYRVLIDDVDSCIFGAIYKFAPSKSYFGGSKDKSQRFVIAFRGTLTKGDAFSRDIQLDIHILRNGLHQTSRFETAIQAVRHVVATFGSSSI # WLTGHSLGAAMAMLAGKTMAKTGVFLDAFLFNPPFLSAPIERIKDQKVKHGIRFATSVITAGLAFAAKHKNVNNQSGDTFVALSAWTPCLYVNPSDPI # CAEYIGYFEHREKMDTMGAGVIEKLATQHSLGGLVLNFMGKECDEPLHLIPSANLTVNLTPPSDFKGAHGIHQWWKPDLLVESKKHQFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 56 # E: 56 (SGN-U321921,SGN-U333012,SGN-U338534,SGN-U327924,SGN-U317845,SGN-U318947,SGN-U319114,...) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 61674 65915 1 - . ID=g6 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 61674 65915 . - . ID=g6.t1;Parent=g6 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 61674 61676 . - 0 Parent=g6.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 61674 62086 . - 2 ID=g6.t1.cds;Parent=g6.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 65429 65915 . - 0 ID=g6.t1.cds;Parent=g6.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 65913 65915 . - 0 Parent=g6.t1 # protein sequence = [MVKSRKPPSGRTNLASCIVATIFLIFIFIIIFILYFTLFKPKSPIITVNSIQLPSFSASNGTVNFTFSQYVSIENPNH # DEFAHYDSSLQLLYSGNRIGFMFVPAGKINSGRTQYMAATFSVKAFPLTVNGQPESVGGPTVTDGLSGFRVGSSMEVESRLEMAGVRLSEFSIARILS # SDTKLELVAGYRAPEVINAHEVSQKSDVYSFGVLLLELLTGKAPLDAFTKNKGVDLPKWTRSMFQEKPVIDVFDTLLPKHDQSSAEQMVLLLQLAVCC # TFQYPNKRPSMAAVTKQIRGTCRFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U326330) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 67327 67542 1 - . ID=g7 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 67327 67542 . - . ID=g7.t1;Parent=g7 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 67327 67329 . - 0 Parent=g7.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 67327 67542 . - 0 ID=g7.t1.cds;Parent=g7.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 67540 67542 . - 0 Parent=g7.t1 # protein sequence = [MLLKKGVETGLTPFDIGNMMCRETLNKESVIEEIIRDAEDSMLPGMTEATFLETVYKLMDIKLEKLKYKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U328451) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 75730 76866 1 + . ID=g8 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 75730 76866 . + . ID=g8.t1;Parent=g8 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 75730 75732 . + 0 Parent=g8.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 75730 76866 . + 0 ID=g8.t1.cds;Parent=g8.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 76864 76866 . + 0 Parent=g8.t1 # protein sequence = [MAGGWADLPIDLLVEIANRIDVLKDFIVFTCVCTSWKIAAPKDKFDVFSPQVPLLMLADKDNDYREYYSLSKKKVSSI # FLPEARGRECCPSEGWLCTMEDSTGDMNLLHALSRIEIQLPSRDDLMASNGLGDDQVLWDWTVKAVLSANPSITSDYILVVMYHANINRLAFWRPGDL # NWTNINISVDRMGDIMDMNYYKGKFYYVTVGGEFWVFEVPGPTTPKLKPTVESQLLYWCEDDIFRHHSVQYYLVELSGALSFVIRYACQFEDHRYKTY # KFEVFEVDLVKGELKMEPIKTLGNLAVFLGSNASCSIESSKFIGIKPNYIYFTDDWHEKFRCLDGAGRDMGAYNFEDGKIESIYSDLSLSHICPPAWI # MPFRIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 80229 82235 1 - . ID=g9 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 80229 82235 . - . ID=g9.t1;Parent=g9 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 80229 80231 . - 0 Parent=g9.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 80229 80461 . - 2 ID=g9.t1.cds;Parent=g9.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 80551 80806 . - 0 ID=g9.t1.cds;Parent=g9.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 81843 82235 . - 0 ID=g9.t1.cds;Parent=g9.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 82233 82235 . - 0 Parent=g9.t1 # protein sequence = [MDFSVIKILFIFSFFVYPEAKALIYPQDLITHDSVFDFPSLNQSFPTSSSPIFRPPTAPLVPALFIIGDSSVDCGTNN # FLGTFARADRLPYGRDFDTHQPTGRFCNGRIPVDYLGNFIKGVFGFCGKLNYWNLYNDQVRKVVVMGLAPIGCAPYYLWLYSSENGECVKNINDMILE # LNFAVRYMVSELNEELVDATIIFCDAFEGSMDIIQNYNRYGFNVTDEACCGLGEYKGWIMCVSPEMACSNASSHIWWDQFHPTDAVNAILADNVWSSL # HTPMCYPMNLQDMLAQSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 84266 89440 1 - . ID=g10 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 84266 89440 . - . ID=g10.t1;Parent=g10 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 84266 84268 . - 0 Parent=g10.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 84266 84498 . - 2 ID=g10.t1.cds;Parent=g10.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 84592 84823 . - 0 ID=g10.t1.cds;Parent=g10.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 89384 89440 . - 0 ID=g10.t1.cds;Parent=g10.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 89438 89440 . - 0 Parent=g10.t1 # protein sequence = [MVLSSDQKSNRGSTIGSEVNLYNDKVRKVVVMGLALIGCAPYYLWLYSSENGECVKNINDMILEFSELNEELADATII # VCDAFEGSVDIIQNYNRYGFNVTDEACCGLGEYKGWIMCVSPEMTCSNASSHIWWDQFHPTDAVNAILADNVWSSLHTPMCYPMNLQDMLAQRTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 96576 103423 1 + . ID=g11 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 96576 103423 . + . ID=g11.t1;Parent=g11 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 96576 96578 . + 0 Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 96576 96901 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 96975 97059 . + 1 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 98822 99256 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 99340 99393 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 99495 99560 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 99932 100027 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 100115 100243 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 100321 100373 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 100689 100884 . + 1 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 101588 101702 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 101909 102183 . + 2 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 102404 102487 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 102583 102695 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 102769 103018 . + 1 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 103250 103423 . + 0 ID=g11.t1.cds;Parent=g11.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 103421 103423 . + 0 Parent=g11.t1 # protein sequence = [MVKNGSDEGSLMKSGDVFLKDILREYKGKLYVPEQIFGANLSEEEEFEKNVEDLPKMSLKDFQKYMKFDKIKLLTFKE # DTGASLGLGSRDFIVELKEMPGEKSLQRTKWAMKLDQNQAQALLEEYTGPRYEVEKQMMSWVGKLPEYPNPAASKISSRVMVELGMLTAAMTAAAVIV # GAFLASAVFAVTSFVFVVTVYVMWPVAKPFLKLFFGLIFGILERVWDKVGDAFTDGGIFSKLYELYTFGGVSASIEMLKPIMLVFVTMVLLVRFTLSR # RPKNFRKWDIWQGIEFSQSKPQARVDGSTGVTFNDVAGIEEAVEELQELVRYLKNPELFDKLGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQM # AGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDPA # LLRPGRFDRKIRIRPPNAKGRLEILKVHARKVKLSDTVDLSSYAQNLPGWSGAKLAQLLQEAALVAVRRGHNSILHSDMDDAVDRLTVGPRRVGIELG # HQGQCRRAITEVGTALTSHLLRQYENAEVERCDRISINPRGQTLSQVVFHRLDDESYMFERLPRLLHRLQVFLGGRAAEEVIYGRDTSRASVNYLADA # SWLARKIITIWNMKNPMAIHGEPPPWVKRVKFVGPRLDFGGSLYDDYDLIEPPINFNLDDDVAKKTEELICDMYGKTVTLLRQHDTALLKTVKVLLNR # TEISGDEIDLILSHYPPNTPTSLLLEERDPASLPFVDEKQEQHNNIEYSLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 89.7 # CDS exons: 14/15 # E: 14 # CDS introns: 12/14 # E: 12 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U328568,SGN-U322962) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 104296 107187 1 + . ID=g12 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 104296 107187 . + . ID=g12.t1;Parent=g12 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 104296 104298 . + 0 Parent=g12.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 104296 104422 . + 0 ID=g12.t1.cds;Parent=g12.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 105773 107187 . + 2 ID=g12.t1.cds;Parent=g12.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 107185 107187 . + 0 Parent=g12.t1 # protein sequence = [MKKPRNIVYNDVVSKPQLSLRLFVSIFCAILLFYSMFVYGYGGISLAYAETITNYSVKDIEFNSSTQPLLESGGKSSK # TEMLLELNISVKINDSCSPTDNIATPEHSLQKTSALEDAVSTILGYNMLICQMQPQVVHIHRNEGRILNGRSHLTYPNLEEFRSITKQEKRGSTASQL # VNITHRLEPDGTPYNYASSSKGAKVVAHNKEAKGANNVLNKDHDKYLRNPCSVAGKFFVIEFADETLVDAVKIANFEHYSSMLKEFELSGSLVYPTET # WNPLGTFVAENVKHAQCFKLPEPKWVRYLKLNLLTHYGSEFYCTISFIEVYGIDAIEQMLEDLIVHSPESSPDKMGNLNKTTMLSMIPDSGSDYHETK # DVVQNVVESANQGLENFDEGQGINLDATRKKQTITNSPEFIKTHRQQSNGRTHGDAVLKILLQKVRALELNLSVLEQYIKELSKRQGDILPELDNEIS # QVSDLLEKSKLEIKDLLKWKENTVCLTITFLLLISRLMHTFQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U326130) # incompatible hint groups: 0 ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 117395 125282 1 + . ID=g13 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 117395 125282 . + . ID=g13.t1;Parent=g13 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 117395 117397 . + 0 Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 117395 117460 . + 0 ID=g13.t1.cds;Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 120179 120375 . + 0 ID=g13.t1.cds;Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 122649 122788 . + 1 ID=g13.t1.cds;Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 123744 123819 . + 2 ID=g13.t1.cds;Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 124425 124667 . + 1 ID=g13.t1.cds;Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 125246 125282 . + 1 ID=g13.t1.cds;Parent=g13.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 125280 125282 . + 0 Parent=g13.t1 # protein sequence = [MTNSLMRKAANDDNAWKALYHKDFTLEQDSLSPINGWKAYYAATRAIMNVNADFFNIIRERSVPAMERFWLNADYVKC # FHASGECFTGHNAVIGSWQLAFNWEQNVDFEIRDVKARVMTDSAWVTMKAYLNMGSEEENGSTDDVLPASINEESSSVLPPGACKGCGRLEIESGCNG # EGRIQGGIATIPGFGWWPIKAYRPCPAFVASGGRYKRFGQSMDEVVSGKGGRVSTVGTDVEVQSSTKKNRTKRSKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 72.7 # CDS exons: 4/6 # E: 4 # CDS introns: 4/5 # E: 4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U322961,SGN-U320351) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 126080 129020 1 + . ID=g14 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 126080 129020 . + . ID=g14.t1;Parent=g14 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 126080 126082 . + 0 Parent=g14.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 126080 126409 . + 0 ID=g14.t1.cds;Parent=g14.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 127041 127146 . + 0 ID=g14.t1.cds;Parent=g14.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 128929 129020 . + 2 ID=g14.t1.cds;Parent=g14.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 129018 129020 . + 0 Parent=g14.t1 # protein sequence = [MDSETSNGIEETVLDILKTSNLEEVSEQKIRRMASEKLGLDLSEPTRKKFVRQVVEKFLAEEQAKREANAADEVKEEE # EDDENDEEEEDGKVKSSGDKEYDDEGDLIVCRLSQKRRVTVTDFRGKTLVSIREYYSKEGKELPTSKGISLTAEQWATFKKNIPGVEQAIKKMESKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U321772) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 130773 132643 1 + . ID=g15 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 130773 132643 . + . ID=g15.t1;Parent=g15 C08HBa0202N15.1 AUGUSTUS_tom_ugs start_codon 130773 130775 . + 0 Parent=g15.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 130773 130904 . + 0 ID=g15.t1.cds;Parent=g15.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 131594 132643 . + 0 ID=g15.t1.cds;Parent=g15.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 132641 132643 . + 0 Parent=g15.t1 # protein sequence = [MGCASSKRIKVAIDVYRPPPTSFAVFDINSIEEPWLKSANNNNKVEENELDQDELDEDEKPIKVAQPILEKLNTSIDD # SPKSWDEVSKALEDLKPTLQNPPPQKSPKKPLLALPAPPPPPSEAAEDGDGSPKRKIPRKSFSFHTLEELESKLSSKDAKKNNEVIKKNEENKKFQRF # NKKNDTQIAVHNGEVEHQRTHSDEGYKPVKENIFLLRDKMEREKEGKVPNFIKFNPLSDYPEKCPPRGDDSLVIYTTSLGGVRRTFEDCNKLRLILES # HRVVFDERDVALHGEFRQELKELLGDGEDAGVPRLFVKGRYIGGVEEVVHLNETKKLGRILNWARVERGLGRLGCEGCGGARFVPCFDCGGSCKVVNG # DVKERCPKCNENGLIHCPICN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U329222,SGN-U321713) ### ### C08HBa0202N15.1 AUGUSTUS_tom_ugs gene 139807 140561 1 - . ID=g16 C08HBa0202N15.1 AUGUSTUS_tom_ugs transcript 139807 140561 . - . ID=g16.t1;Parent=g16 C08HBa0202N15.1 AUGUSTUS_tom_ugs stop_codon 139807 139809 . - 0 Parent=g16.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 139807 139848 . - 0 ID=g16.t1.cds;Parent=g16.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 139936 140046 . - 0 ID=g16.t1.cds;Parent=g16.t1 C08HBa0202N15.1 AUGUSTUS_tom_ugs CDS 140483 140561 . - 1 ID=g16.t1.cds;Parent=g16.t1 # protein sequence = [SFGGSNIDPSAWEDKKNPGESRFPAQVRVVTRKVCEPLEEDSFRPVLHHYDGPKFRLELNVPEAISLLDIFEENKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U313699) ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C08HBa0202N15-AxHDA/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C08HBa0202N15-AxHDA/AUGUSTUS_tom_ugs/seq_with_defline_removed