##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C11HBa0161D01-kMtbc/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C11HBa0161D01-kMtbc/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 108762, name = C11HBa0161D01.2) ----- # # Set orientation to forward for hint group HintGroup SGN-U329740, 4196-5582, priority= 4 7 features # Delete group HintGroup SGN-U324134, 17739-86241, priority= 4 3 features # Delete group HintGroup SGN-U337964, 17739-86241, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U326707, 21793-23664, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U326839, 27364-30498, priority= 4 7 features # Set orientation to forward for hint group HintGroup SGN-U328864, 38678-41225, priority= 4 19 features # Set orientation to forward for hint group HintGroup SGN-U319056, 41240-45241, priority= 4 18 features # Set orientation to reverse for hint group HintGroup SGN-U321594, 50381-56355, priority= 4 13 features # Delete group HintGroup SGN-U320628, 59665-65379, priority= 4 23 features # Set orientation to forward for hint group HintGroup SGN-U326731, 68651-70607, priority= 4 3 features # Delete group HintGroup SGN-U321300, 73460-74699, priority= 4 2 features # Set orientation to forward for hint group HintGroup SGN-U342051, 79560-81944, priority= 4 7 features # Set orientation to forward for hint group HintGroup SGN-U323661, 85440-90549, priority= 4 11 features # Set orientation to forward for hint group HintGroup SGN-U327565, 97734-99337, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U321213, 103115-107696, priority= 4 9 features # Set orientation to forward for hint group HintGroup SGN-U321214, 103817-107696, priority= 4 7 features # Forced unstranded hint group to the only possible strand for 12 groups. # Deleted 4 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 4281 5627 1 + . ID=g1 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 4281 5627 . + . ID=g1.t1;Parent=g1 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 4281 4283 . + 0 Parent=g1.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 4281 4433 . + 0 ID=g1.t1.cds;Parent=g1.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 4513 4638 . + 0 ID=g1.t1.cds;Parent=g1.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 5274 5433 . + 0 ID=g1.t1.cds;Parent=g1.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 5512 5627 . + 2 ID=g1.t1.cds;Parent=g1.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 5625 5627 . + 0 Parent=g1.t1 # protein sequence = [MSVIDIILRVDTICKKYEKYDVEKHSANDSPGDAFARLYSSFESQIDATSEKAEMAAMETNRAKAVAMKAEVRRTKAR # LMDEIKKLHKLAQKKVKGLSQEELETRGDLVHMLSERIQAIPDGSINAAKTTGGRGTSSFNKNIKFDSEGQFNEGFYEQTEEGTHFRSEYEIRKMKQA # CNFPILVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 4/4 # E: 4 # CDS introns: 3/3 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U329740) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 16229 21938 1 - . ID=g2 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 16229 21938 . - . ID=g2.t1;Parent=g2 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 16229 16231 . - 0 Parent=g2.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 16229 16301 . - 1 ID=g2.t1.cds;Parent=g2.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 21772 21938 . - 0 ID=g2.t1.cds;Parent=g2.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 21936 21938 . - 0 Parent=g2.t1 # protein sequence = [MAPTPATLKPKSKSPAGLNPTSGNDDLPAADDSGVERIAMHGTTVLFFGISLFVVFTRGISIDDEVVMMASPPSSLTN # H] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 33.3 # CDS exons: 1/2 # E: 1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U326707) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 26114 30152 1 - . ID=g3 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 26114 30152 . - . ID=g3.t1;Parent=g3 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 26114 26116 . - 0 Parent=g3.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 26114 26323 . - 0 ID=g3.t1.cds;Parent=g3.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 27351 27476 . - 0 ID=g3.t1.cds;Parent=g3.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 28879 28965 . - 0 ID=g3.t1.cds;Parent=g3.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 29819 29993 . - 1 ID=g3.t1.cds;Parent=g3.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 30091 30152 . - 0 ID=g3.t1.cds;Parent=g3.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 30150 30152 . - 0 Parent=g3.t1 # protein sequence = [MIQSVCVRASALPLPPIDSHRNAAMANSFAIDAQNLSYSVVSKQGKILPILKDCSLQVPSGQFWMLLGPNGCGKSTLL # KILAGLLSPDDGFLYVERPRSFVYQNPDHQVVMPTVEADVAFGLGKLNLTPNEIKTRVAKALDAVGMYEYLKIGVIKAMRNSMDTSQGITALWVTHRL # EELEFADGAVYMEDGRIVRQGDATSIRKFIEDKLTSYVNQINL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 77.8 # CDS exons: 4/5 # E: 4 # CDS introns: 3/4 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U326839) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 38602 45059 1 + . ID=g4 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 38602 45059 . + . ID=g4.t1;Parent=g4 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 38602 38604 . + 0 Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 38602 38712 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 38789 38884 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 39692 39804 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 39895 39961 . + 1 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 40043 40135 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 40244 40393 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 40540 40628 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 40738 40843 . + 1 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 40940 41027 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 41122 41240 . + 2 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 41707 41868 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 41955 42151 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 42311 42420 . + 1 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 42698 42807 . + 2 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 42972 43085 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 43238 43339 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 43949 44160 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 44279 44615 . + 1 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 44952 45059 . + 0 ID=g4.t1.cds;Parent=g4.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 45057 45059 . + 0 Parent=g4.t1 # protein sequence = [MTSFAANVTYDHRALVVDGRRRVLISGSIHYPRSTPDMWPDLIQKSKDGGLDVIETYVFWNLHEPVRNQYDFEGRKDL # INFVKLVEKAGLFVHIRIGPYVCAEWNYGGFPLWLHFIPGIEFRTDNEPFKAEMKRFTAKIVDMIKQENLYASQGGPVILSQIENEYGNGDIESRYGP # RAKPYVNWAASMATSLNTGVPWVMCQQPDAPPSVINTCNGFYCDQFKQNSDKTPKMWTENWTGWFLSFGGPVPYRPVEDIAFAVARFFQRGGTFQNYY # MYHGGTNFGRTSGGPFIATSYDYDAPLDEYGLINQPKWGHLKDLHKAIKLCEAAMVATEPNITSLGSNIEVSVYKTDSQCAAFLANTATQSDAAVSFN # GNSYHLPPWSVSILPDCKNVAFSTAKINSASTISTFVTRSSEADASGGSLSGWTSVNEPVGISNENAFTRMGLLEQINTTADKSDYLWYSLSVNIKND # EPFLQDGSATVLHVKTLGHVLHAYINGKLSGSGKGNSRHSNFTIEVPVTLVPGENKIDLLSATVGLQNYGAFFDLKGAGITGPVQLKGFKNGSTTDLS # SKQWTYQVGLKGEDLGLSNGGSTLWKSQTALPTNQPLIWYKASFDAPAGDTPLSMDFTGMGKGEAWVNGQSIGRFWPAYIAPNDGCTDPCNYRGGYNA # EKCLKNCGKPSQLLYHVPRSWLKSSGNVLVLFEEMGGDPTKLSFATREIQSVCSRISDAHPLPIDMWASEDDARKKSGPTLSLECPHPNQVISSIKFA # SFGTPQGTCGSFIHGRCSSSNALSIVKKACIGSKSCSLGVSINAFGDPCKGVAKSLAVEASCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 19/19 # E: 19 # CDS introns: 18/18 # E: 18 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U328864) # incompatible hint groups: 2 # E: 2 (SGN-U331485,SGN-U319056) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 45499 56149 1 - . ID=g5 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 45499 56149 . - . ID=g5.t1;Parent=g5 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 45499 45501 . - 0 Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 45499 46217 . - 2 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 46833 46952 . - 2 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 50638 50729 . - 1 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 51005 51102 . - 0 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 51775 51966 . - 0 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 52430 52503 . - 2 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 54560 54647 . - 0 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 55888 56015 . - 2 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 56098 56149 . - 0 ID=g5.t1.cds;Parent=g5.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 56147 56149 . - 0 Parent=g5.t1 # protein sequence = [MVVGVLALQGSFNEHIAVLKRLGVKGVEVRKPEQLLNVSSLIIPGGESTTMAKLAELHNLFPALREFVQMGKPVWGTC # AGLIFLANKATGQKTGGQKLIGGLDCTVHRNFFGSQIQSFETELPIPQVVAEDGGPPSFRAVFIRAPAILDVGPDVEVLSDIPLSAIETLNSNPAIQK # EEESTESGKKVIVAVKQGNLLATAFHPELTADTRWHSYFLKMVPEIEGGTSDIVSTSTSNQSFGTPLLLLSIFSQVTIADQPEGKGKEVNAVATDPGY # NVLDPLPGRLPRCDGYGALCYDPRFVGGDGVMFYFHGAKETDFAIVSDDNLHINAHLIGTRPQGRKRDYTWVQTLSVMFDTHTLVVGATEVSHWDDKV # DALIVQWNGETVNVPTDGDVEWSVNTAERSVVVERTDDLNSVRVTVSGLLQLDVKVVPIGEKENKVHNYQLPADDAFAHLETQFKFFNLSKDVEGILG # KTYQPGYVSPVKRGVPMPIMGGEDKYQTPSLHSAICKNCRFQRPSSVASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 70.6 # CDS exons: 6/9 # E: 6 # CDS introns: 6/8 # E: 6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U321594,SGN-U321086) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 60459 70437 1 + . ID=g6 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 60459 70437 . + . ID=g6.t1;Parent=g6 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 60459 60461 . + 0 Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 60459 60794 . + 0 ID=g6.t1.cds;Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 60966 61040 . + 0 ID=g6.t1.cds;Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 63667 63762 . + 0 ID=g6.t1.cds;Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 64288 64325 . + 0 ID=g6.t1.cds;Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 68750 68829 . + 1 ID=g6.t1.cds;Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 69668 70437 . + 2 ID=g6.t1.cds;Parent=g6.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 70435 70437 . + 0 Parent=g6.t1 # protein sequence = [MSVMMHSVDEVTEMGCCGCFGFSFARKPKKEIRPNRGYGNSWSHEPLLQQEAEEVEDDGFDSGDIIDTGSEDDEVCHS # PVKRYQEILMERAQNGLICREIPVKETHKVVRTEDEDGNKMVNEYVREHKIGAGSYGKVNIIHGDIKPDNLLVSAAGKVKIGDFSVSQVFEEIDIMEN # VLTRGRNGIITTLVFISGDANLRLAEISSWISDKESLAVGSELLVFGRELFDFAIWKYSLIQNNWEKCEGMNHRRCLFGSGSLGSISIVAGGSDKNGN # VLKSAELYDSLTGTWEILPNMHSPRRLCSGFFMDGKFYVIGGMTNPTDSLTCGEEFDLQTRKWRKIEGMYPNVNRAAQAPPLVAVVNNQLYAVEYLTN # MVKKYDKKNNSWEVLGRLPVRADSSNGWGLAFKACGEELLVVGGNRGPEGEAIILSSWAPKSGCKDGTLDWKVIGLKEHSGVFVYNCAVMGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 18.2 # CDS exons: 1/6 # E: 1 # CDS introns: 1/5 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U326731) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 74211 75371 1 - . ID=g7 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 74211 75371 . - . ID=g7.t1;Parent=g7 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 74211 74213 . - 0 Parent=g7.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 74211 75371 . - 0 ID=g7.t1.cds;Parent=g7.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 75369 75371 . - 0 Parent=g7.t1 # protein sequence = [MKRDDEKLTKDVFKELMEKDFLDLNANALCVGKKSSFAALVLRELGLLSAVGVDAHPYFSLVWRRFMYELDHENNSFD # FVFSRDLDKVTVPALMVLEIERVLRPGGTGVMLVGSSSFYAGNLVKGNLIRSATPVSSFLKSSDVVHVCGVGTYTLVMFKKRSEIVQSLVHSVLPANC # PSNVNNKPYLKHLEPLVEKKLGQFETQISYLPKFMNISSRNKLVYINVGAGEFVESTLARTFKPHYPIPHHLFNVFVIDHNTSTLSLYVKNPGINFVY # HPGLAVAGETTLSSVDTDEYLGAPLDHEGFDFIHWFSETVKDGDYVILMMNARAPELNILAELFQTGSICHVDELFLRCSAADCRNALCGDCMSLFKT # LRRSGVFAHQWWGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U324719) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 79062 90230 1 + . ID=g8 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 79062 90230 . + . ID=g8.t1;Parent=g8 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 79062 79064 . + 0 Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 79062 79718 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 81330 81422 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 81510 81824 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 81936 82061 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 85359 85532 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 85644 85778 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 86875 86970 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 88784 89218 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 89823 89866 . + 0 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 89981 90230 . + 1 ID=g8.t1.cds;Parent=g8.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 90228 90230 . + 0 Parent=g8.t1 # protein sequence = [MSTETVNPELNGEESSEKLHSPVIVKSELNGDDSSEHLQLPETLKTELNGEDSSEQLHSSAIVKPELNGDESSELVKL # TEALAEPTEKRKREGSETVTETEQKQQNPLWKTTLCSYFRRNDGSCSHGESCRYAHGESELRVRPDNTWDPTSDRAKKMAKTAADDDGEKAEDKEEKC # NDVMMTEALDDDECSSVSGLSKCLVNLPMKWSSDNLRCFLKEHGVTFKSAKKKKGMAVGFATFENAEQVKTAVKELDGKPAGNKILKVGDIIPRAFER # KGNSAMSSFRTNQQGEKQTEAGDGLDLTKISEETEAEDPVTSDSVLKGRCVRDVVTPLAKMPYADQLEQKKSSLTRTLKTLTRNARKACPNGVPLPEW # ILKAREIGMLFLNCIGCKWLYDYIFDHTGISNVAPADAPLRVLPFSREESYSELHADNAVAEAKIHDFINGLKFCISPTAFFQVNTLAAEKLYSLAGD # WASLGPDTLLFDVCCGTGTIGLTLANRVGMVVGIEMNASAVSDAQRNAEINGIKNCRFICGKAEDVMGSVLKEYLASPAKVDGLLDIEEKKNQENTTS # TEKTDSIVNASKTDGESSTGSENGKSMCIDQDTTPTENMYSTDRAAEPEEKTGLECTNGKSLSESSADDTTEPATQLKKCSSDNLTTPVQHFKNVVAI # VDPPRAGLHPTVIKLLRTNSRLRRLVYISCNPESLVANAIELCTPSPDESEKGDNRNNRLWRKMSSATLARHRTKSMPNSEPFKPVKAMAVDLFPHSP # HCELVMLLER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 94.7 # CDS exons: 10/10 # E: 10 # CDS introns: 8/9 # E: 8 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U342051) # incompatible hint groups: 6 # E: 6 (SGN-U323661,SGN-U334543,SGN-U319540,SGN-U315525,SGN-U319112,SGN-U342126) ### ### C11HBa0161D01.2 AUGUSTUS_tom_ugs gene 104024 107321 1 + . ID=g9 C11HBa0161D01.2 AUGUSTUS_tom_ugs transcript 104024 107321 . + . ID=g9.t1;Parent=g9 C11HBa0161D01.2 AUGUSTUS_tom_ugs start_codon 104024 104026 . + 0 Parent=g9.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 104024 104045 . + 0 ID=g9.t1.cds;Parent=g9.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 105959 106024 . + 2 ID=g9.t1.cds;Parent=g9.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 106266 106557 . + 2 ID=g9.t1.cds;Parent=g9.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs CDS 107255 107321 . + 1 ID=g9.t1.cds;Parent=g9.t1 C11HBa0161D01.2 AUGUSTUS_tom_ugs stop_codon 107319 107321 . + 0 Parent=g9.t1 # protein sequence = [MALLVMLDHLPLGLLDCLLPGPVTLVLRRGESSILEKSLNPGLESIGVRVPDCNFIRVIARGSRSALALTSANLSGQP # SSIDIKDFENLWEHCAYVYDGGILPAGRAGSTVVDLTKLGKYKILRPGSAKEETIAILERHSLLEDGTGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 4/4 # E: 4 # CDS introns: 3/3 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U321213,SGN-U321214) ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C11HBa0161D01-kMtbc/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C11HBa0161D01-kMtbc/AUGUSTUS_tom_ugs/seq_with_defline_removed