BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Tomato Genome proteins (ITAG release 4.0) 34,075 sequences; 11,664,535 total letters Query= Untitled_sequence Length=218 Score E Sequences producing significant alignments: (Bits) Value Solyc03g117020.4.1unnamed protein product 329 3e-116 >Solyc03g117020.4.1 unnamed protein product Length=215 Score = 329 bits (844), Expect = 3e-116, Method: Compositional matrix adjust. Identities = 152/200 (76%), Positives = 174/200 (87%), Gaps = 2/200 (1%) Query 19 DSGYTSASAAASGKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVD 78 DS Y S + ++ EGV+ITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGV D Sbjct 17 DSDYISTTPVSAASEGVQITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVDD 76 Query 79 SNSYWIVKPVPGTTEKQGDAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCFGDDT 138 +NSYW V+ + KQGD +KSG+ IRLQH+KTR+WLHSHLHASPISGN+EVSCFGDD Sbjct 77 ANSYWAVRST--DSSKQGDPIKSGSIIRLQHIKTRRWLHSHLHASPISGNMEVSCFGDDK 134 Query 139 NSDTGDHWKLIIEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKK 198 SDTGD+W+L IEGSGKTW+QDQR+RLQH+DT GYLHSHDKKY RIAGGQQEVCG++EK+ Sbjct 135 ESDTGDYWRLEIEGSGKTWRQDQRIRLQHVDTGGYLHSHDKKYTRIAGGQQEVCGVKEKR 194 Query 199 ADNIWLAAEGVYLPLNESSK 218 DN+WLAAEGVY P+ E SK Sbjct 195 PDNVWLAAEGVYFPVTEKSK 214 Lambda K H a alpha 0.315 0.132 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1049224140 Database: Tomato Genome proteins (ITAG release 4.0) Posted date: Mar 21, 2024 4:18 PM Number of letters in database: 11,664,535 Number of sequences in database: 34,075 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40