BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Tomato Genome proteins (ITAG release 4.0) 34,075 sequences; 11,664,535 total letters Query= Untitled_sequence Length=81 Score E Sequences producing significant alignments: (Bits) Value Solyc01g098890.1.1unnamed protein product 166 5e-56 >Solyc01g098890.1.1 unnamed protein product Length=82 Score = 166 bits (421), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%) Query 1 MLARTSIILLLMIFVTIQQGVLGGRGYLMEQDNNNINMEDNAQSPVATTRSISHIIGDDE 60 MLARTSIILLLMIFVTIQQGVLGGRGYLMEQDNNNINMEDNAQSPVATTRSISHIIGDDE Sbjct 1 MLARTSIILLLMIFVTIQQGVLGGRGYLMEQDNNNINMEDNAQSPVATTRSISHIIGDDE 60 Query 61 GGFVAYVNREVPSSPDPLHNR 81 GGFVAYVNREVPSSPDPLHNR Sbjct 61 GGFVAYVNREVPSSPDPLHNR 81 Lambda K H a alpha 0.318 0.136 0.386 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 286886415 Database: Tomato Genome proteins (ITAG release 4.0) Posted date: Mar 21, 2024 4:18 PM Number of letters in database: 11,664,535 Number of sequences in database: 34,075 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40