##gff-version 3
# This output was generated with AUGUSTUS (version 2.0.2).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de).
# Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and
# a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225
# No extrinsic information on sequences given.
# Initialising the parameters ...
# human version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C09HBa0043M08-5GML1/AUGUSTUS_ab_initio/seq_with_defline_removed is in fasta format.
# We have hints for 0 sequence and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 121739, name = C09HBa0043M08.1) -----
#
# Constraints/Hints:
# (none)
# Predicted genes for sequence number 1 on both strands
###
C09HBa0043M08.1	AUGUSTUS_ab_initio	gene	64353	66839	1	-	.	ID=g1
C09HBa0043M08.1	AUGUSTUS_ab_initio	transcript	64353	66839	.	-	.	ID=g1.t1;Parent=g1
C09HBa0043M08.1	AUGUSTUS_ab_initio	stop_codon	64353	64355	.	-	0	Parent=g1.t1
C09HBa0043M08.1	AUGUSTUS_ab_initio	CDS	64353	64608	.	-	1	ID=g1.t1.cds;Parent=g1.t1
C09HBa0043M08.1	AUGUSTUS_ab_initio	CDS	66694	66839	.	-	0	ID=g1.t1.cds;Parent=g1.t1
C09HBa0043M08.1	AUGUSTUS_ab_initio	start_codon	66837	66839	.	-	0	Parent=g1.t1
# protein sequence = [MTLRAVIFTIDHGDAVRVELVLRFGGAERGLNQLNTTNNLTSLSPHNDPSSSQLFLFLLQLFLFLSGYSSRQQQPSDN
# SQQQPSNSSKQQPSSSRNSRQHQPPGVAQPASSESAGQRLHNGVKPLSRPIQKPK]
###
# command line:
# /usr/bin/augustus.real --species=human --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C09HBa0043M08-5GML1/AUGUSTUS_ab_initio/seq_with_defline_removed