##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C04HBa0114C15-ReOgb/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C04HBa0114C15-ReOgb/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 117225, name = C04HBa0114C15.1) ----- # # Set orientation to forward for hint group HintGroup SGN-U316263, 486-18444, priority= 4 40 features # Set orientation to forward for hint group HintGroup SGN-U335564, 10305-12849, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U331859, 17187-23419, priority= 4 9 features # Set orientation to forward for hint group HintGroup SGN-U330812, 25141-36892, priority= 4 13 features # Set orientation to forward for hint group HintGroup SGN-U330643, 40227-44058, priority= 4 13 features # Set orientation to reverse for hint group HintGroup SGN-U345789, 48516-51862, priority= 4 7 features # Delete group HintGroup SGN-U334034, 60812-60941, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U327023, 68664-71883, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U334635, 72980-73884, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U313864, 72980-75511, priority= 4 5 features # Delete group HintGroup SGN-U334634, 73137-74839, priority= 4 5 features # Delete group HintGroup SGN-U334636, 73144-74357, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U326505, 84776-90091, priority= 4 11 features # Forced unstranded hint group to the only possible strand for 10 groups. # Deleted 3 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 448 15711 1 + . ID=g1 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 448 15711 . + . ID=g1.t1;Parent=g1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 448 531 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 1098 1220 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 1318 1430 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 1683 1845 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 2520 2612 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 2763 2848 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 4914 5000 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 6648 6751 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 6864 6966 . + 1 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 7080 7175 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 7440 7629 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 7827 7888 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 8415 8519 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 10291 10492 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 10568 10776 . + 2 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 12755 12879 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 12980 13031 . + 1 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 13119 13205 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 14697 14819 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 15460 15711 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 15709 15711 . + 0 Parent=g1.t1 # protein sequence = [VVTSKYYSVQLQKHLSAENHPYHKFSTGSWDTLEVRPKERGIDTRQELLKFYSENYSANLMHLVVYSKDSLDKVEQLV # RGKFQDIRNIDRNQIHFTGQPCIMEHLQILVRAVPIKQGHKLKIIWPITPGIHHYKEGPCRYLGHLIGHEGEGSLFYVLKKLGWATSLSAGESDWTNE # FSFFKVAIDLTDAGQDHFEDIMGLLFKYIHLLQQAGASKWIFEELSAICETAFHYQDKIRPSDYVVNVAMNMQHYPPEDWLVASSLPSKFNPSIIQSF # LNELNPDNVRIFWESTKFEGNTSMTEPWYGTAYSIEKVGGDSIKQWMEHAPSEELHLPAPNVFIPTDLSLKPVFEKTKVPILLRKSPYSRLWYKPDTA # FSSPKAYVMIDFSCPYCGHSPEAEVLTEIFTRLLMDYLNEYAYNAQVAGLYYDISKTNSGFQLTLFGYNDKLRVLLEAVIEKVAKFEVKPDRFSVVKE # LVTKQYQNFKFQQPYQQVMYYCSLLLKDNIWPWNEELEVLPHLKVDDLVKFYPLLMARSFMECYVAGNVEQAEAESMIQLIEDVFFKGPQSISKPLFA # SQHLTNRVVNLERGVNYVYAAEGLNPSDENSALVHYIQVHQDDFMLNVKLQLFALIAKQPAFHQLRSVEQLGYITVLMQRSDSGVHGVQFIVQSTAKD # PKYIDTRVELFMKMFESKLYEMTSDEFKNNVNALIDMKLEKHKNLREESRFYWREISDGTLKFDRRDREIVALKQLTQKELTDFFDEYIKVGVPRKKA # LSVRVYGSSHSSQFQAHKNEQMEPNAVQIEEIFSFRRSRPLYSSFKGGFGHVRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 97.5 # CDS exons: 20/20 # E: 20 # CDS introns: 19/20 # E: 19 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U335564) # incompatible hint groups: 1 # E: 1 (SGN-U316263) ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 17360 44271 1 + . ID=g2 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 17360 44271 . + . ID=g2.t1;Parent=g2 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 17360 17362 . + 0 Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 17360 17488 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 17587 17662 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 18395 18462 . + 2 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 23204 23295 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 23368 23441 . + 1 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 25083 25205 . + 2 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 25290 25402 . + 2 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 26181 26343 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 26805 26897 . + 2 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 27078 27163 . + 2 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 32340 32426 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 36801 36904 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 40276 40394 . + 1 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 40478 40686 . + 2 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 41430 41554 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 41671 41722 . + 1 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 41820 41906 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 43221 43343 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 44002 44271 . + 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 44269 44271 . + 0 Parent=g2.t1 # protein sequence = [MAVGKADEPVEIFKARSDKREYRRIVLQNSLEVLLITDPETDKCAASMEVSVGYYSDPKGLEGLAHFLEHMLFYASEK # YPVENSYSKYITQHGGSTNAFTSSERTNFYFDINADCFEEALDRFAQFFVKPLMSPDATTREIKAVDSGNWDTLEVQPKARGLNTRQELLKFYKENYS # ANLMHLVVYAKDCLDKTQTLVQGIFQEVPNTNRSYSPVTDQPCKSEHLQILVRAVPIKQGHSLRLEWPIIPDLAHYKEGPSLYLSHLIGHEGEGSLFY # VLKKLGWATSLSAGESGGGHHFSFFEVYISLTDAGHDHFEDVVALVFKYIHLLQQAGARKWIFDELSAISETNFHYQDKSSPIGYVVYVASNMQLYPP # IDWLVGSSLPSKFSPDIIEAVLTDLTPQNVREHSWSWDDECEALTNLEIDDLVKFYPLLLSRTFLECYLAGNIDSKEAVSMIQHVEDALYKGSQPLSR # ALFASEHSSSRIINLEESKNYFYAAEGLNTSDENSALVHYIQVHSDEYIKNVKLQLFALIAKQPAFDQLRSVEQLGYITSLSRTSDAGVRGLQLIVQS # SVKDPRYIESRFQAFLKTLETQLHDMSDDEFKKKVNALIDIKLEKFKNLPEETNFFWWEISSGTLKFDRIENEVAALKQITKTDLIDFFNEYVNVGAP # KRKSLSLQVFGSSHFSEFKSEKVDPAEPNVVQIEDIFCFRRSRPLHHSLKGDLVHLKAHDIDHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 91.9 # CDS exons: 18/19 # E: 18 # CDS introns: 16/18 # E: 16 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U330812) # incompatible hint groups: 9 # E: 9 (SGN-U316263,SGN-U331859,SGN-U325588,SGN-U336043,SGN-U328123,SGN-U324118,SGN-U337959,...) ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 47739 51892 1 - . ID=g3 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 47739 51892 . - . ID=g3.t1;Parent=g3 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 47739 47741 . - 0 Parent=g3.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 47739 48695 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 49349 49493 . - 1 ID=g3.t1.cds;Parent=g3.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 51659 51744 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 51845 51892 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 51890 51892 . - 0 Parent=g3.t1 # protein sequence = [MAEANNFTLSSSFLKQVYLYDWWLIKVETGDGSKRLGVGGFTAKERPDGRVFHSTTIAKRHDTTTLVTEDGITILLSG # FINRCRTLQNGFSSEVCKQFLLGFPYNWEESAAVSFGESTNENAASRISDFSESANASADCTSSSFTLSVDHLSPNVLRDLLISAAGDPEGGMLRKSI # FNEIVQKYGNNAFNVDEASSLNQKSGNQVTPQSPSLNGSPSQKKKAKTNRKQEDSCIADAKSGKEKLPEATPKDMPEKRVLDRLLHRSGDDVPIVGEN # SCLNQKSGNQVSSRGPSLDETPYKKKKTRANLRKEDDKHVPNAQCRKEVLPKCNDESGTDIDKNSSSSSALTRDKASLYKKTKIYLTQEEKRDVHKVS # GQGDFGIVNITNSSNGPLTRSRAKMKRVKEQGQEGHRYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 4/4 # E: 4 # CDS introns: 3/3 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U345789) # incompatible hint groups: 0 ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 53389 62836 2 - . ID=g4 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 53389 62836 . - . ID=g4.t1;Parent=g4 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 53389 53391 . - 0 Parent=g4.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 53389 54986 . - 2 ID=g4.t1.cds;Parent=g4.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 55059 55663 . - 1 ID=g4.t1.cds;Parent=g4.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 61907 62253 . - 0 ID=g4.t1.cds;Parent=g4.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 62654 62836 . - 0 ID=g4.t1.cds;Parent=g4.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 62834 62836 . - 0 Parent=g4.t1 # protein sequence = [MSYATSVSDSKFKSTDSSTITADDYDDEDADCDDDASFAEAKANARRIKMIRMIRVINKLKAVRRRRSKSLCISDCLK # ISSGKPKPAFSLATSCTSASSCVSNDSTAAGDISSGGSCEAVLKERECVPRKMKVIFSAHMRRRAEAILKVLSSHGCASEVRIRQLLGDSPDTSKALR # ILITLGVSNSGAAGISSFEELDVSGFNKLGISDFEKIGVSKFGKLGVSCFGKLGFSDFGELAVSGFWELGVSGFEKLGVSKLEVSGFGELGISGFAEL # AVSGFRELGVSGFGELGISGFTELDILGFGELGVLASGKLGVSAFAKLGVSGFGELDFSGFVELGISSFGELGILGFEKLGVSGFGELGNSDFGELGV # SGFEKLGVSGFRKLEALRELEVLGFEKLGASGFEKLGILGVGVLGSSGFEELGVSGFEKLGVLGFEKLSVSGFEKLRVSGFREFDVLGLGELGISESV # KVGVLGFGELGVSGFGKLGISGFEKLGVSDFGELGVSGFEKIGISCFRELEALGELEVLGFEKLGILGVEVLGSSGFEELGVSGFEKLGVSGFEKLGI # SCFEKLGVSDFGEFGVLGLRELGISGSAKVEVSDFGELGVSAFEKLGVSNFGELDVADFEKLGVSSFGKLGVSGFEKLGVSSFGKLGISGFEKVGASN # FGELGVSGFEKLGISNFVKLGVSGFEIFGISGFEKVGFSSINKVGVSGFWEVGVTRSDDVEVSGIEKLGVSGFEEVGFSDFDEPGALRSSFGELGVSG # FEKLRVSGFEKLGVSGFEKLGVSGFKKVGVSGFEKLGVSDFEKLSVSGFEKLGVSGFEKLEASNFEKLGVSDFEKLGISGFEKLGVSDFEKLGASCLE # KLGVSDFEKVGVSGFEKVGVSSFEKLGVSGFEKLVASGFEKLGVSDFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 61801 62836 . - . ID=g4.t2;Parent=g4 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 61801 61803 . - 0 Parent=g4.t2 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 61801 62253 . - 0 ID=g4.t2.cds;Parent=g4.t2 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 62654 62836 . - 0 ID=g4.t2.cds;Parent=g4.t2 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 62834 62836 . - 0 Parent=g4.t2 # protein sequence = [MSYATSVSDSKFKSTDSSTITADDYDDEDADCDDDASFAEAKANARRIKMIRMIRVINKLKAVRRRRSKSLCISDCLK # ISSGKPKPAFSLATSCTSASSCVSNDSTAAGDISSGGSCEAVLKERECVPRKMKVIFSAHMRRRAEAILKVLSSHGCASEVRIRQLLGDSPDTSKALR # MSVSLSLPVDLGPMDGDISEDPNNHQIYFYLKKHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 67928 72270 1 + . ID=g5 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 67928 72270 . + . ID=g5.t1;Parent=g5 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 67928 67930 . + 0 Parent=g5.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 67928 69144 . + 0 ID=g5.t1.cds;Parent=g5.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 70869 70995 . + 1 ID=g5.t1.cds;Parent=g5.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 71803 72270 . + 0 ID=g5.t1.cds;Parent=g5.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 72268 72270 . + 0 Parent=g5.t1 # protein sequence = [MQAKLGFRVVDYLPYDSYVRKTVGYLFAIQHGAKKILDVDDRGDVIDDDIGKHFDVELIGEDARQEVILQYSHDNPNR # TVVNPYIHFGQRSVWPRGLPLENVGEIGHEEFYTEIFGGKQLIQQGISNGLPDVDSVFYFTRKAGFEAFDIRFDEHAPKVALPQGMMVPVNSFNTLFH # SSAFWGLMLPVSVSTMASDVLRGYWTQRMLWEIGGYVVVYPPTIHRYDRIEGYPFSEEKDLHVNVGRLTKFLVAWRSSKHRLFEKILELSYAMAEEGF # WTVQDVKFTAAWLQDLLAVGYMQPRLMALELDRPRASIGHGDRKEFVPQKLPSVHLGVEEIGTVNYEIANLIKWRKNFGNVVLIIFCSGPVERTALEW # RLLYGRIFKTVIILSDQKNVDLAVEKGNLDYMYRYAPKILDRYTSAEGFLFLQDDTILNYWNLLQADKSKLWIGNKVSKSWHAVPVANKSDWFVKQAD # VVKKVVATMPVHLQVNYKETMRSDETLTICSSEIFYIPRRFVSDFVDLINLVGNLDVHHKVAMPMFFTAMDSPQNFDSVLNSMIYKKKSPGNLTTFYS # AEAPAIHPWKVSSEQEFIKLIRVMAAGDPLLMELV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 2 # E: 2 (SGN-U327023,SGN-U326753) # incompatible hint groups: 1 # E: 1 (SGN-U327024) ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 73154 77011 1 - . ID=g6 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 73154 77011 . - . ID=g6.t1;Parent=g6 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 73154 73156 . - 0 Parent=g6.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 73154 73531 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 73633 74109 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 74208 75967 . - 2 ID=g6.t1.cds;Parent=g6.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 76966 77011 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 77009 77011 . - 0 Parent=g6.t1 # protein sequence = [MHQGNQMGRVKEKIKDKGNVGTAAYLNVFASIYSVLKDLKKDGYNVEGLPETSAELIEEVIHDKEAQFSSPNLNVAYK # MNVREYQKLTPYATALEENWGKAPGNLNSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYSFVEKIFKADAVLHFGTHGSL # EFMPGKQVGMSDACFPDSLIGNIPNVYYYAANNPSEATIAKRRSYANTISYLTPPAENAGLYKGLKQLSELIASYQSLKDSGRGPQIVSSIISTARQC # NLDKDVDLPDEEKEIDAKERDLVVGKVYAKIMEIESRLLPCGLHIIGEPPTAMEAVATLVNIAALDRAEDDISSLPSILAATVGRNIEEIYRGNDNGV # LRDVELLRQITEASRGAISAFVERSTNNKGQVVDNSDKLTSLLGFSINEPWIQYLSNTQFYRADREKLRVLFQFLGECLKLIVANNEVGSLKQALEGK # YVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAALQSAKIVVERLLERQKIDNGGKYPETVALVLWGTDNIKTYGESLAQVMWMIGVRPVADTLGR # VNRVEPVSLEELGRPRVDVVVNCSGVFRDLFINQMNLLDRGIKMVAELDEPEDQNFVRKHALEQAKTLGIDVREAATRVFSNASGSYSSNINLAVENS # SWNDEKQLQDMYLSRKSFAFDCDAPGAGMMEKRKVFEMALSTADATFQNLDSSEISLTDVSHYFDSDPTNLVQNLRKDGKKPSAYIADTTTANAQVRT # LSETVRLDARTKLLNPKWYEGMLSTGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANTTFIKDEEMLNRLMNTNPNSFRKLLQTFLEANGRGYWDT # SEENIEKLKQLYSEVEDKIEGIDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 71.4 # CDS exons: 3/4 # E: 3 # CDS introns: 2/3 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 2 # E: 2 (SGN-U313865,SGN-U313863) # incompatible hint groups: 3 # E: 3 (SGN-U334635,SGN-U313864,SGN-U334633) ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 77144 78589 1 - . ID=g7 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 77144 78589 . - . ID=g7.t1;Parent=g7 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 77144 77146 . - 0 Parent=g7.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 77144 78589 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 78587 78589 . - 0 Parent=g7.t1 # protein sequence = [MASLVSSPFTLPNSKVEHLSSISQKHYFLHSFLPKKTNPTFSKSPKKFQCNAIGNGLFTQTTQEVRRIVPENLKGLAT # VKIVYVVLEAQYQSALTAAVQTLNKNGEFASFEVVGYLVEELRDENAYKTFCKDLEDANIFIGSLIFVEELALKVKSAVEKERDRLDAVLVFPSMPEV # MRLNKLGSFSMSQLGQSKSPFFQLFKKKKSSAGFSDQMLKLVRTLPKVLKYLPSDKAQDARLYILSLQFWLGGSPDNLVNFLKMVSGSYVPALKGVKM # DYSDPVLYLDSGIWHPLAPCMYDDVKEYLNWYATRRDTNEKLKSSSAPVIGLVLQRSHIVTGDESHYVAVIMELEARGAKVIPIFAGGLDFSGPVERY # FIDPITKKPFVNSVVSLTGFALVGGPARQDHPRAIEALTKLDVPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFSGRDPRTGK # CPFVMLITVYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04HBa0114C15.1 AUGUSTUS_tom_ugs gene 84970 90098 1 - . ID=g8 C04HBa0114C15.1 AUGUSTUS_tom_ugs transcript 84970 90098 . - . ID=g8.t1;Parent=g8 C04HBa0114C15.1 AUGUSTUS_tom_ugs stop_codon 84970 84972 . - 0 Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 84970 85127 . - 2 ID=g8.t1.cds;Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 85752 85876 . - 1 ID=g8.t1.cds;Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 86342 86472 . - 0 ID=g8.t1.cds;Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 86595 86672 . - 0 ID=g8.t1.cds;Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 87235 87340 . - 1 ID=g8.t1.cds;Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs CDS 90010 90098 . - 0 ID=g8.t1.cds;Parent=g8.t1 C04HBa0114C15.1 AUGUSTUS_tom_ugs start_codon 90096 90098 . - 0 Parent=g8.t1 # protein sequence = [MSSNLELEVRSSATVPSLQVPTFHHTPYYCEENIYLLCKKLCDDGLADPNGSDLFVIFISNEKKQIPLWHQKASQRAE # GVILWDYHVICVQKKRNENSSSLVWDLDSSLPFPSSLGTYVADSIRPSIQIFSEFKRFFRVVHAPIFLRHFASDRRHMKDSAGNWTADPPSYEAIVAE # DGAVHNLNEYITVSPDDVVKNVEADTVNVVLSEKLGVVIGEDDLLGFFSLIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 6/6 # E: 6 # CDS introns: 5/5 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U326505,SGN-U329401) ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C04HBa0114C15-ReOgb/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C04HBa0114C15-ReOgb/AUGUSTUS_tom_ugs/seq_with_defline_removed