##gff-version 3
# This output was generated with AUGUSTUS (version 2.0.2).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de).
# Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and
# a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225
# reading in the file /tmp/bac-submission-temp-C04HBa0132M08-bEpi1/AUGUSTUS_tom_ugs/hints.gff ...
# Sources of extrinsic information: M E 
# Have extrinsic information about 1 sequences (in the specified range). 
# Initialising the parameters ...
# human version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C04HBa0132M08-bEpi1/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format.
# We have hints for 1 sequence and for 1 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 84928, name = C04HBa0132M08.1) -----
#
# Set orientation to forward for hint group HintGroup SGN-U313178, 361-4342, priority= 4 3 features
# Set orientation to reverse for hint group HintGroup SGN-U320430, 5159-8601, priority= 4 21 features
# Set orientation to reverse for hint group HintGroup SGN-U316689, 10508-16715, priority= 4 9 features
# Delete group HintGroup SGN-U339909, 13615-13725, priority= 4 3 features
# Set orientation to reverse for hint group HintGroup SGN-U330286, 19372-20338, priority= 4 5 features
# Delete group HintGroup SGN-U314496, 24972-25273, priority= 4 3 features
# Set orientation to reverse for hint group HintGroup SGN-U341421, 43787-45497, priority= 4 3 features
# Set orientation to forward for hint group HintGroup SGN-U330810, 53492-59276, priority= 4 35 features
# Set orientation to forward for hint group HintGroup SGN-U331707, 69498-74011, priority= 4 17 features
# Set orientation to reverse for hint group HintGroup SGN-U345833, 79656-81310, priority= 4 9 features
# Forced unstranded hint group to the only possible strand for 8 groups.
# Deleted 2 groups because some hint was not satisfiable.

# Constraints/Hints:
# Predicted genes for sequence number 1 on both strands
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	446	4161	1	+	.	ID=g1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	446	4161	.	+	.	ID=g1.t1;Parent=g1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	446	448	.	+	0	Parent=g1.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	446	796	.	+	0	ID=g1.t1.cds;Parent=g1.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	3688	4161	.	+	0	ID=g1.t1.cds;Parent=g1.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	4159	4161	.	+	0	Parent=g1.t1
# protein sequence = [MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILASVNKANSELSSHQKKIFKVDDHIGVAIAGLT
# ADGRVLSRYMRTECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKF
# ETFMDSSRESLLKDALFALRETLQGEKLTSSNCTVAVVGVGEAFHTLDKETIQALINEFEIAGEDAPAEVPEEAATDEPAAPEEGAAPADQGAAPMDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 2/2
#      E:   2 
# CDS introns: 1/1
#      E:   1 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 2
#      E:   2 (SGN-U313178,SGN-U340776)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	5068	8591	1	-	.	ID=g2
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	5068	8591	.	-	.	ID=g2.t1;Parent=g2
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	5068	5070	.	-	0	Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	5068	5331	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	5710	5821	.	-	1	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	5930	6027	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	6318	6425	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	6633	6671	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	6784	6855	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	6938	7201	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	8418	8591	.	-	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	8589	8591	.	-	0	Parent=g2.t1
# protein sequence = [MGVEIRPATINGENQSESVNIGAPVVLGLQPFALVDHIAKVDWSLLSQIPGERGGSFPVAVEELKYILNELNAHILPS
# TDNESILKTIAGGSVANTIRGLAAGFGISSGIIGACGEDEEGKLFMSNMGFYKVDLSRLRLKNGTTAQCVCLVDEVGNRTMRPCLSGSVKVQADELKR
# EDFKGSKWLVLRYAILNVEVIKVAIKIAKEEGLFVSLDLASFEMVRKFKSPLIELLESGNIDLCFANEDEATELLRGEEKADPDAALEYLAKYCKWAV
# VTLAQNGCIAKHEKEFVRVPAIGEAKVTDATGAGDLFASGFLYGLVRGLSLEECCRVGSCSGGSVIRSLGGEVTPENWQWMYKQMQTNGLQLPEPSKS
# SVVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 8/8
#      E:   8 
# CDS introns: 7/7
#      E:   7 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U320430)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	11130	16568	1	-	.	ID=g3
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	11130	16568	.	-	.	ID=g3.t1;Parent=g3
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	11130	11132	.	-	0	Parent=g3.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	11130	11414	.	-	0	ID=g3.t1.cds;Parent=g3.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	12251	12402	.	-	2	ID=g3.t1.cds;Parent=g3.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	12472	12597	.	-	2	ID=g3.t1.cds;Parent=g3.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	14115	14258	.	-	2	ID=g3.t1.cds;Parent=g3.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	16454	16568	.	-	0	ID=g3.t1.cds;Parent=g3.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	16566	16568	.	-	0	Parent=g3.t1
# protein sequence = [MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNVFDKAPVVDKDVFVAPGASVIGDVHVGRNSS
# IWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVKQNTRIP
# SGEVWAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDEEYDSMIGVVRETPPELVLPDNILPEKAAKSIAQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 5/5
#      E:   5 
# CDS introns: 4/4
#      E:   4 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 2
#      E:   2 (SGN-U316689,SGN-U335785)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	19659	21890	1	-	.	ID=g4
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	19659	21890	.	-	.	ID=g4.t1;Parent=g4
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	19659	19661	.	-	0	Parent=g4.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	19659	19825	.	-	2	ID=g4.t1.cds;Parent=g4.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	19909	20112	.	-	2	ID=g4.t1.cds;Parent=g4.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	20210	20270	.	-	0	ID=g4.t1.cds;Parent=g4.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	21195	21890	.	-	0	ID=g4.t1.cds;Parent=g4.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	21888	21890	.	-	0	Parent=g4.t1
# protein sequence = [MSPKSSPTRNGPQVLSTDQLTSKAASTASDQTSANPSDITSQMQPNDIISQPTSPPKQSHDSSEISPKSTETLPSNSE
# KEPMLTTVEPQSEQMELLKKEAISETSTEAKDKSPQKVKPSDSSRIITEPKTARPLEINIPETKEVKEVVQETTDKNYREQPDIVFQSKQAYTEKQAS
# SDNDQIRVNCVSNGKQTRTISAEQDVPLNKEVKDNISKLINRMTVGDGKQKLEEGPPGVTAPPRDKVIIPGDGNVKAVFNEEHDIGTYTIKAIDDPRT
# LNKTLYIRPLKNTLSFNELVAIWEKLIGKTLEKIYVPEEQILKDIQTSPIPINIILAINHSTFVKGDQTNFEIEPSFGVEASELYPDVKYTTVEEYLG
# HFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 57.1
# CDS exons: 2/4
#      E:   2 
# CDS introns: 2/3
#      E:   2 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U330286)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	23367	25115	1	+	.	ID=g5
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	23367	25115	.	+	.	ID=g5.t1;Parent=g5
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	23367	23369	.	+	0	Parent=g5.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	23367	23582	.	+	0	ID=g5.t1.cds;Parent=g5.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	25002	25115	.	+	0	ID=g5.t1.cds;Parent=g5.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	25113	25115	.	+	0	Parent=g5.t1
# protein sequence = [MNKVFARFGRVISFPVVHSKEANDIMVSEFTMQQKGLENTTVADVLMIKDEEKGNSWLCCRTNDTAYDAIKKGVGDDR
# RGSKIGTFDQGELNKVETKMMDIPRKIEEDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U331953)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	40248	46380	1	-	.	ID=g6
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	40248	46380	.	-	.	ID=g6.t1;Parent=g6
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	40248	40250	.	-	0	Parent=g6.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	40248	41829	.	-	1	ID=g6.t1.cds;Parent=g6.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	45407	45524	.	-	2	ID=g6.t1.cds;Parent=g6.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	46143	46380	.	-	0	ID=g6.t1.cds;Parent=g6.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	46378	46380	.	-	0	Parent=g6.t1
# protein sequence = [MAGESESAAEPNPNTLTPSNPPSADAINIVPLQTHSPPTKLPSRPRKTRKLSNTVDPCLPKTQISTIVPRIVSRSLSY
# EGNVVGNSNVSLQQQILSMQQQQQQQHQQFLDPINGILNVGVVSQTRPKVAIAQREYIKHVEKYVATSSNKKLSDALKKIRWISTEDFKGKKMKMQVE
# NVNVGYNGCNVDDVYLIQYTSGTTAIPKPVLVTAGSAAHNVRVARRAYDLQPNTVVVSWLPQYHDCGLMFLLLTIVSGATCVLTSPSTFVNRPRIWLE
# LISEFKATCTPVPSFALPLVLKRGHTEATVTGTVSNPISMLSLMNLIIVNEPIYNDSIEEFVEVFRPFGLNPLAISPSYGLAENGTFVSTSWRSSKFN
# KFSTYKKLLPSARLDEDQVDIEILVVNEDTNEIVEDGIEGEIWISSPSNAIGYLAHPSLTQQVFNATLKNKAGKCYVRTGDRGVIKGEERFLYVTGRC
# SDAIKLSNGQEIHPHYLETLAYNSCPNFLRGGCVAAFEMSESEYTSIVAVVVEVQSKCEIESDMFLKQICEGIRKTMLKEEGVGIGLVVLVKFGNVPK
# TTSGKIQRWLAKYKFEKSQMNIIMQMKFDNNGYIQSTMQKMIQIGKKEAKKGKKVLVVEEEEGLFFAPTNKTLKSSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 40
# CDS exons: 2/3
#      E:   2 
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 1
#      E:   1 (SGN-U327997)
# incompatible hint groups: 1
#      E:   1 (SGN-U341421)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	53657	59049	1	+	.	ID=g7
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	53657	59049	.	+	.	ID=g7.t1;Parent=g7
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	53657	53659	.	+	0	Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	53657	53773	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	54761	54823	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	54903	54992	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	55094	55153	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	55257	55322	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	55423	55488	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	55581	55656	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	56330	56394	.	+	2	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	56484	56576	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	56685	56768	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	56855	56939	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	57532	57578	.	+	2	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	57729	57791	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	57873	57932	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	58028	58093	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	58188	58247	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	58543	58657	.	+	0	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	58937	59049	.	+	2	ID=g7.t1.cds;Parent=g7.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	59047	59049	.	+	0	Parent=g7.t1
# protein sequence = [MGSRQSSMMGSSQAIRDSSISVLACVLIVALGPIQFGFTCGYTSPTQIAITKDLKLTVSEFSLFGSLSNVGAMVGAIS
# SGQISEYIGRKGSLMIAAIPNIIGWLAISFAKDPSFLYMGRLLEGFGVGIISYVVPVYIAEIAPQNMRGGLGSVNQLSVTIGIMLSYLLGLFVNWRLL
# AVLGALPCLALIPGLFFIPESPRWLAKMGLTEDFETSLQVLRGFEADITNEVNEIKRSVASSTNRRTAMRFADLKHRRYWFPLMVGIGLLILQQLGGI
# NGVIFYSSNIFLSAGISSSNAATFGVGAIQVVATAVSTWLVDRTGRRILLIVSSAGMAVSLLIVSVAFYLKGYVSEDSTLYGVLGIVSVVGVVFMIIS
# FSLGMGPIPWLIMSEILPIKIKGLAGSTATLANWLFSWVITVTAPLLMAWSSGGTFTIYMVMCAFTVAFVAIWVPETKGRTLEEIQFSFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 18/18
#      E:  18 
# CDS introns: 17/17
#      E:  17 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U330810)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	61671	63224	1	-	.	ID=g8
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	61671	63224	.	-	.	ID=g8.t1;Parent=g8
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	61671	61673	.	-	0	Parent=g8.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	61671	63224	.	-	0	ID=g8.t1.cds;Parent=g8.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	63222	63224	.	-	0	Parent=g8.t1
# protein sequence = [MNGATGTQVNTANGGGGEPVGVQIQQSRRLPDFLQSVNLKYVKLGYHYLISHLLTLCLIPVMAVILIEASQMNPDDIR
# QLWLHLQYNLVSVIICSAVLVFGSTVYIMTRPRPVYLIDYSCYKAPEHLKAPYERFMQHSRLTGDFDESSLEFQRKILERSGLGDETYVPEAMHQLPP
# QPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVV
# STENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTL
# GPLVLPISEQLLFFGSLIIKKIFNKHIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMKK
# GNKVWQIAFGSGFKCNSAVWQALRNVKPSPDGPWEDCIDRYPVKVVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 1/1
#      E:   1 
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U320020)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	69605	73980	1	+	.	ID=g9
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	69605	73980	.	+	.	ID=g9.t1;Parent=g9
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	69605	69607	.	+	0	Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	69605	69631	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	69741	69812	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	70557	70631	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	71831	71911	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	72578	72647	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	72723	72814	.	+	2	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	73517	73558	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	73650	73730	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	73909	73980	.	+	0	ID=g9.t1.cds;Parent=g9.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	73978	73980	.	+	0	Parent=g9.t1
# protein sequence = [MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRVSIGESEGDAEPT
# LLITCDQVVVYEGVIREKPSSEAEARQFMKDYANGHAATVSSVLVTNLTTGSRRGEWDKVEIYFHDIPDQVIDKLIEEGIVLYAAGGLIIEHPLVLPY
# IKEVVGSTDSVMGLPKALTERLIKEVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 9/9
#      E:   9 
# CDS introns: 8/8
#      E:   8 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U331707)
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	75122	75382	1	-	.	ID=g10
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	75122	75382	.	-	.	ID=g10.t1;Parent=g10
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	75122	75124	.	-	0	Parent=g10.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	75122	75382	.	-	0	ID=g10.t1.cds;Parent=g10.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	75380	75382	.	-	0	Parent=g10.t1
# protein sequence = [MATNSTWSHHQNKLFENALAIYDIDTPDRWRKLANAVGGKTEEEVKNHYEKLVEDIKRIESGNIPLPNYNGGRNNKGY
# NFMDEEQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
###
###
C04HBa0132M08.1	AUGUSTUS_tom_ugs	gene	79850	81370	1	-	.	ID=g11
C04HBa0132M08.1	AUGUSTUS_tom_ugs	transcript	79850	81370	.	-	.	ID=g11.t1;Parent=g11
C04HBa0132M08.1	AUGUSTUS_tom_ugs	stop_codon	79850	79852	.	-	0	Parent=g11.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	79850	79972	.	-	0	ID=g11.t1.cds;Parent=g11.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	80043	80105	.	-	0	ID=g11.t1.cds;Parent=g11.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	80398	80457	.	-	0	ID=g11.t1.cds;Parent=g11.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	80656	80713	.	-	1	ID=g11.t1.cds;Parent=g11.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	CDS	81255	81370	.	-	0	ID=g11.t1.cds;Parent=g11.t1
C04HBa0132M08.1	AUGUSTUS_tom_ugs	start_codon	81368	81370	.	-	0	Parent=g11.t1
# protein sequence = [MVSGSVIIAIFTCLQQLQLLRIQRDHIEDEIHHLKWSLKSEETDDASKEMFSELHKLQSKGEEVRLSHQQAQRECHQK
# FHKVWGQLMKTGYQNSRFAHQVERFACLYTSQVTNLSLYSPDKYYRPSEDFMPHEFGILSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 100
# CDS exons: 5/5
#      E:   5 
# CDS introns: 4/4
#      E:   4 
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 1
#      E:   1 (SGN-U345833)
###
# command line:
# /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C04HBa0132M08-bEpi1/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C04HBa0132M08-bEpi1/AUGUSTUS_tom_ugs/seq_with_defline_removed