##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C04HBa0207A03-OjpQJ/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C04HBa0207A03-OjpQJ/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 129756, name = C04HBa0207A03.1) ----- # # Set orientation to forward for hint group HintGroup SGN-U317587, 279-8516, priority= 4 29 features # Delete group HintGroup SGN-U320330, 8903-10884, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U329656, 14743-16286, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U341962, 23479-25173, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U333195, 34932-35779, priority= 4 3 features # Delete group HintGroup SGN-U330438, 58432-58970, priority= 4 2 features # Set orientation to forward for hint group HintGroup SGN-U332223, 61949-63517, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U346105, 64486-65331, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U335099, 76165-77166, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U315339, 76202-78444, priority= 4 9 features # Set orientation to reverse for hint group HintGroup SGN-U325489, 78600-80667, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U312842, 93481-96410, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U325449, 96559-98737, priority= 4 5 features # Forced unstranded hint group to the only possible strand for 11 groups. # Deleted 2 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 298 8270 1 + . ID=g1 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 298 8270 . + . ID=g1.t1;Parent=g1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 298 373 . + 1 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 774 908 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 994 1164 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 1932 2084 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 2190 2258 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 2355 2471 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 3015 3089 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 3232 3309 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 3387 3482 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 3656 3705 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 4781 4835 . + 1 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 5107 5238 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 6436 6483 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 6583 6741 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 8130 8270 . + 0 ID=g1.t1.cds;Parent=g1.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 8268 8270 . + 0 Parent=g1.t1 # protein sequence = [FSRTNLLAMAASSAIASSSTTFINKKDVGLSAFSSQASFSVQTARKRISKRIVSVMTPQQTERKPATTGSVKTGMTMT # EKILAKASDKPDVSPGDNVWVNVDVLMTHDVCGPGSIGIFKKEFGQNAKVWDREKLVIIPDHYIFTTDERANRNVDILRDFCNEQNIKYFYDIKDLGN # FRANPDYKGVCHVALAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTLRFVMDGEMPDYLLAKDLILQIIGEISVAG # ATYKAMEFVGTTVESLTMEERMTLCNMVVEAGGKNGVIPADKTTYDYLEGRTSVPYEPVYSDEGARYLKEYRFDVSKLEPLVAKPHSPDNRALARECK # DVKIDRVYIGSCTGGKTEDFMAAAKVFLASGKKVKVPTFLVPATQKVWMDVYSLPVPGSGGKTCSQIFEEAGCDTPASPSCGACLGGPKDTYARMNEA # QVCVSTTNRNFPGRMGHKEGQIYLASPYTAAASALTGYVTDPREFLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 96.7 # CDS exons: 15/15 # E: 15 # CDS introns: 14/15 # E: 14 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U317587,SGN-U339583,SGN-U339582) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 9123 10067 1 - . ID=g2 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 9123 10067 . - . ID=g2.t1;Parent=g2 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 9123 9125 . - 0 Parent=g2.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 9123 10067 . - 0 ID=g2.t1.cds;Parent=g2.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 10065 10067 . - 0 Parent=g2.t1 # protein sequence = [MEDRNTPHTHNNEIKQNNDSNVDVPKPILRRIKSERSERIALDDISIGNNSSIVAIPSKTKGVDHEKESSILSISFEP # PIHMMKKKGKASSVINGAELINEKSKLENKKIKTSSVLSDSIVSKGSSIYDKPNPKPKLKLIELEMGPKYEPINEKGPCYDPPTTKEIDEQSITKSSM # KIYGNEFGGPKGPLTESEIGPSASIVAAALVERGYLLDDKRSSVLDGWSIDESTEGLRSKLERWRNEIPPVQNRGTGSSSYRSTGRHPRRRSSGGSSL # FSCFGNICGYECQCMCGKPKKKSVSNKKYKSPSTASRSWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U346633) # incompatible hint groups: 1 # E: 1 (SGN-U320328) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 10404 15782 1 + . ID=g3 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 10404 15782 . + . ID=g3.t1;Parent=g3 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 10404 10406 . + 0 Parent=g3.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 10404 10421 . + 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 12758 13162 . + 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 14579 14806 . + 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 14997 15169 . + 0 ID=g3.t1.cds;Parent=g3.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 15641 15782 . + 1 ID=g3.t1.cds;Parent=g3.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 15780 15782 . + 0 Parent=g3.t1 # protein sequence = [MMVSTEDEDFKEMINDGKLVRAVTIGNEIEDLASDDFSFGKCIMDLIKEDDDNEDCDEKEDKETEEQNEPVCPMYLAA # GFGIDVSGMKSLTEGGLMRAGHGADIVPLNFDEMGDVEAHYKSLLEEYPFNPLVLRNYAQLLQETEEVATSHNMYFEQDNRQASPLLNLAAGFGIGNC # GFSGGMTLNELIAAEDYYKSVIQENPNNPLVLRKYAQFLDQCKGDLGGAKEYYSRAVLTDASDGEIISQYANFIWHLHHDQNKASSHFKRAVQASPGN # CDVLASYARFLWETEEDEDEDEDKDKESNNYKYQFQYFHGVMVTPNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 55.6 # CDS exons: 3/5 # E: 3 # CDS introns: 2/4 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U329656) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 23232 24652 1 - . ID=g4 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 23232 24652 . - . ID=g4.t1;Parent=g4 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 23232 23234 . - 0 Parent=g4.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 23232 23575 . - 2 ID=g4.t1.cds;Parent=g4.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 24610 24652 . - 0 ID=g4.t1.cds;Parent=g4.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 24650 24652 . - 0 Parent=g4.t1 # protein sequence = [MEMLFKTCSGKNAPGSGFEERRDTAFSTLENGMASSNGFYTTSYQSVYTMGQCEGDVGSADCADCVKNAVQKAQVECG # SSVSGQIFLHKCFIGYSNSPNGVPRTSRSSSDWSPSSSSGITYTDIDPLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U341962) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 29288 32748 1 + . ID=g5 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 29288 32748 . + . ID=g5.t1;Parent=g5 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 29288 29290 . + 0 Parent=g5.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 29288 29509 . + 0 ID=g5.t1.cds;Parent=g5.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 31687 32748 . + 0 ID=g5.t1.cds;Parent=g5.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 32746 32748 . + 0 Parent=g5.t1 # protein sequence = [MDSDQGKLFIGGVSWETSEEKMKEYFQGYGDVVQTVVMRDKITGKPRGFGFVVFADPSVIDRVLQDTHVIDGRTVEAK # RALSREEQQGPKSGNMGGGRSFGGSGNTRTKKIFVGGLPPTLTEDDFRIYFETYGNVTDVAIMYDQQTNRPRGFGFISFDSEDAVDRVLHKAYHDLSG # KQVEVKRALPKDSNSGFGGRSTGNGGSGMGGGSYQGYGDNPSSYDRMDTNRYMQSQNTGGGYPSYGSSGYGTAGYGYGSSNNGMGYGAYGSYGGANPG # YGGVNPGYGGAAGAAFGNPNVPGTGYGSGQAGGPRSSWGSQVSSGYGNMGYGNVSWGASSAGGGGGPANGGSAAGQSPTGATGYGNQGYGYGGYGGND # GSYGGGASGDMQSGGGYMGSGYGDASGNSQGSGNYGAQQNGPYGGGAPSRQAQQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 33.3 # CDS exons: 1/2 # E: 1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U325243) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 33988 36313 1 - . ID=g6 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 33988 36313 . - . ID=g6.t1;Parent=g6 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 33988 33990 . - 0 Parent=g6.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 33988 35519 . - 2 ID=g6.t1.cds;Parent=g6.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 35644 36313 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 36311 36313 . - 0 Parent=g6.t1 # protein sequence = [METILKQIDNIVINGVSTSLLPLRDQITNIVGLEEDIGRVCRSMLSDYSSFPSSSSSHIGVPVVIPIYGVVGSGKTTL # ARSVHENSAIVERFENRIWIDVPREDFDVGYILENIMESVNHGWMRCSSSKKQLQERVGRIFNSKRSLFVFDDVRYIQAWETLYGALPELYSGSYVLV # TTRVEYVAKYISKKHSQPVHNMNSLNEDDSWRLFDMVLSHSHRASSSDREMVRCCYGLPGLIKHLASYKTSDQSFISEYYCLLYKQELPKELQPCFIY # LGHFLENQLIDPEKLSHLWMIEGLLSTRQSVVKGHQSMTERYLKELERMGVVELQPEEVPTTNKLFKAYRFVQGMEKFCVSNCEEKCFLKIIDLRREN # CSLSSSDRPRRLVIYLGNRTVEIPPKVSKTILSLRVVLLGNQHTPTEMLNLKEFKGLRVLDFDGIDFKTLKLLTGISNLELLRYLSLKGCILDALPSS # ISKLSYLRVFDLRVEKGASAIKIPNVLWELRRLKHLYLPLEFATQNGEKLRLNSLTQLETLVNFNTSLCRANDVSTLCKLHYLEAKVENNFPDFESIT # SYLTSNKCPLHCSIDIIDLNCSAPERSTVLEEFLGCEVLQTLKFKGFIGPLLPSPKISPNLTQLRLHKSCLKQDPMPILEKLPSLGILGLNDDAYMGK # DMVCSASGFPQLKCLQLLNLSELQRIHVENTAMPILSNIEIDNCQKLDINSIQQFHAVLLEKKQTRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U333195) # incompatible hint groups: 1 # E: 1 (SGN-U345188) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 43642 48015 1 - . ID=g7 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 43642 48015 . - . ID=g7.t1;Parent=g7 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 43642 43644 . - 0 Parent=g7.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 43642 45804 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 47578 48015 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 48013 48015 . - 0 Parent=g7.t1 # protein sequence = [MAETTLEFALSSLTQQLVDNMGVIGVIKDEVSCLLSELHHLRAFLIDSNRNRRGSKILKHFVEELNRAINKAENSIDK # FMIEVTLHKKRGIYRIFDLCYLVKAKRCCSDIRSIMEKLKEIRRDTAYALSLSLQLDDSKQTAHQLKRAPVVEEDEVVGFDEEADEIINRLLGGSDDV # EFISIVGMPGLGKTTLANKVFKSVGYEFYNRIWVYVSQSYTRRDLFLKIINQFTRNTEQYRYVTEEALAEVIRKHLLFGKYLIVLDDVWTQEPLDDVK # IALPNKMRGKVLFTTRDDEVGKFCCNEPHHIKFLTDHECWELLQKKVFHKDKCPLDLEVLGKRIAKKCMGLPLAALVIAGALTGRGKTKSEWEIVHQF # VSEHIISSDIRMTKKLVQMSCDSLPVNLKACFLYCGAFPKGSEIPAWKIVRLWIAEGFIRETTGSKIESVAEGYLNELVSKSLLMVTQRTSNGQIKTF # RVHDMLHEFCTLEASEENFFKEIKLGVEQSFPRNQELSTFRRLSIDSSVQEFISTNPYGDGIRSFLCFSSRNIAMSPYELETIPKSFPLLRVLDIESI # LFELETIRKSPFRKQFFQLYHLRYLAISSDSLKILPKFMEDLWNLQTLIISTQQETLNIEADICNMPHLRHVHTNASGKLCPSVLKTRNHRSALQTLS # IIEAETLTEDVFARCQNLKKLGIRGDMTKLVGLLKLEYLEKLKLMNLASGKLQLDSENYGFPRRLKQLTLSGTWLDWEEIHRAVGHLELLEVLKVKEN # AFRGDSWELKKDYVFPCLKVLWIERSELVCWKGCDENFPSLERLVLRNLNKLEEIPINFANISNLKMMELVNTTKSTVKSAQKIESQSVCTGFKLTIF # PPDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 33.3 # CDS exons: 1/2 # E: 1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 2 # E: 2 (SGN-U327603,SGN-U345672) # incompatible hint groups: 1 # E: 1 (SGN-U345745) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 49814 52512 1 + . ID=g8 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 49814 52512 . + . ID=g8.t1;Parent=g8 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 49814 49816 . + 0 Parent=g8.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 49814 50738 . + 0 ID=g8.t1.cds;Parent=g8.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 51374 52512 . + 2 ID=g8.t1.cds;Parent=g8.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 52510 52512 . + 0 Parent=g8.t1 # protein sequence = [MEKLAATMKLEQLALAKETQLIGSKAYEEIMETVHCIKNLETTDREQVNEIEEHVYRVENAIQTYGVRSKSNLFLNRH # GAAQKKAMTDITSLCRVMKGIALLQKSNNNQQLMRQNNKFVYNHEDGAVVVGMEDEKEEIIQVLLLNSQVSSEVDFQAVPIWGRSGMGKATLVNEIYN # DPRIVKEFGHPHLVNIRLSENINAHDALQHVFELFEGSRIDDKYVDMSTTSLEDCVRQHLEMSRTLIVLQGVGSIDDWRMLRSVLGAKGCIILITTRA # RQVAESITQAIHIHEKRPLTEENSWKLFKEMVWPGKYDAEIKPELASNIWSLRIIRSVVGEFAWPSTLMSNIKEFKSLRILDFGRVDFPRGELPKGIS # DLQFLRYLSFEGCFLAKLHSSISNLSYLQVLDLRTQYKENGNNTIIPYNVFQKMARLQHLYLPLVFQLQNGKKLRLDGLAELQTLKNLNSKLCEIRHL # FKLKKLRNLDAKVEVCVEDLNLITDFMKSRSDKGLRRCSLEVKNFDCYSDTKHSAFREILNSGVPPIVSFEGYIKTLPPYFDISQNFTEIVLRSTQLE # EDPMPTLEKLNNLRLLVLEDDAFKVNQMVCSASGFQELKHLELSRLFSFEKWRVEISAMPMLSHLKIEYCNELVTLPDGSEFLDSLQEFKMIKMPESF # TQKVTERYDHNHKRPPSFIVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 33.3 # CDS exons: 1/2 # E: 1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U332541) # incompatible hint groups: 0 ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 58772 60142 1 - . ID=g9 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 58772 60142 . - . ID=g9.t1;Parent=g9 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 58772 58774 . - 0 Parent=g9.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 58772 60142 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 60140 60142 . - 0 Parent=g9.t1 # protein sequence = [MSSVGRVIRRCPNSDSRVVPFIRFGPLFGQDEEGSSVREAKEEAWKHVMKNSKPSEAIVTEIYMSCIRNIEKKAKDSY # DPDPVIWDKLSNSDFRDMMLKDTCLFLQLSFSLFRAVDNKLDDGELVDFPHLRNMISLSKRHKWVESMLHVGNQIPLVVIREVLKQSYFRQVVDNGKW # KEPLFDPVKKSLFRILLSPTEYYWFGKHAMHWTQELKECCDVLHGIHLLLVGPEIDPEKDEYEDDDDENDHIGDVEENRVTNTNSGGSSSSDDDATKK # NNDKLLKNVIELKQAGIYFGVTKKGAGIKGIRFKSNLIYPKLYLPPLFIGCYTQLLLENQTQYEQTLDSSLRQVSSYLIFMRDLVRTTQDAKILVSDG # IVKGNRKYIQKLPAILIHLVPHNDKIIDPNLTSVNIEINSFYQPPWVTSYFTILFSFTLFGVIISIAQTIYAVLAYHKPPSSPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 61762 62070 1 - . ID=g10 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 61762 62070 . - . ID=g10.t1;Parent=g10 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 61762 61764 . - 0 Parent=g10.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 61762 62070 . - 0 ID=g10.t1.cds;Parent=g10.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 62068 62070 . - 0 Parent=g10.t1 # protein sequence = [MVEPEGVLGLATPAGEDGPLTPLPPPDFLRDGDFFNIFNPNAVFTLLVIAIPTPVGFGDPGPDKPVPDPDPFPSPDPS # DDEEIATVLPPNPGDDLHAVKKIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U327917,SGN-U332223) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 62126 66092 1 + . ID=g11 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 62126 66092 . + . ID=g11.t1;Parent=g11 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 62126 62128 . + 0 Parent=g11.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 62126 62191 . + 0 ID=g11.t1.cds;Parent=g11.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 63085 63966 . + 0 ID=g11.t1.cds;Parent=g11.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 64044 64496 . + 0 ID=g11.t1.cds;Parent=g11.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 64850 65036 . + 0 ID=g11.t1.cds;Parent=g11.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 65119 66092 . + 2 ID=g11.t1.cds;Parent=g11.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 66090 66092 . + 0 Parent=g11.t1 # protein sequence = [MRVSEQSDNRLRKTLMRTLVGQIGRRAETIILPLELLRHLKPSEFNDPQEYHLWQKRQLRILDIGLLLHPSIPVEKDN # ASASRLLEIIQACEIKTIDTSKNSETMKSLSNAVVSLAWRSVDDTPSDTCRWADGFPLNIHIYTALLGSIFDLKDDTLVLNEVDELLELMKKTWSTLG # ITRSIHNLCFTWVLFEQYVVTNQVEPDLLGATLTMLTEVANDAKKLDRDPIYLKMLKSVLASMKRWCEKRLLNYHASFHAENIGLMENIIPLMFSASK # ILEEDVPGYVSSAAEKGDVKDDSTGNQVNHFIRSSLRTAFNKMLEERNINITTFENDDVIETLIKLANATEEMATKEKKVFTPVLKKWHPIAAGVAAV # TLHTCYGTLLRQYLAGTTFLTSETALVLQRAGKLEKVLVQMVVEDSVDCEDGGKVMVREMIPYEVDSIKINLLRKWIQDSLKKGKDVLVRSKDSETWN # PKSKSEPYAQSAIDLVRHSKEAVDNFFEIPTIITENLVNDIADGIENLFKDYVIFVASCGAKQNYMPALPPLTRCGQDSKFVKMWKKAACSVGSNDPN # QHLTDEDNNPRPSTSRGTQRLYVRLNTLHYLLQQLNSLDKTLSLSSRVIASPGSRYNKNRQLACCSFFDQTRSSIQASVQLVSEVAAYRLMFFDSNSV # FYASLYVGDVENARIRPALRILKQNLTLLCAILTDRAQALALKEVMRASFGAYLMVLLAGGPRRNFFRMDHQMIEEDFESLKKVFCTCGEGLILEDVV # EKEAAIVEEIVSLMGQSTEQLVEDFSNLACETSGAGVVVGNGEKLPMPPTTGKWNRSDANTILRVLCHRNDKIANNFLKKTFHLAKRRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 77.8 # CDS exons: 4/5 # E: 4 # CDS introns: 3/4 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U346105) # incompatible hint groups: 2 # E: 2 (SGN-U332223,SGN-U328885) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 67148 70784 1 + . ID=g12 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 67148 70784 . + . ID=g12.t1;Parent=g12 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 67148 67150 . + 0 Parent=g12.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 67148 67801 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 69259 69393 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 69504 70784 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 70782 70784 . + 0 Parent=g12.t1 # protein sequence = [MAPTPKNQRTPTPFSKLNLTHIPNSRTPQAKHRLNFTTAKPNSVAPVAAAAEHPIEVIGRIRDYPDRKEKPLSLLQVN # PDRETLRVKTDGGYRDFSFDGVSLSEEEDIDEFYKKFVQSRINGVKLGDKCTVMMYGPTGAGKSYNMFGSSKQPGIVYRSLRDILGDGIEETDENNEK # ISVGTFVQVTVLEIYNEELYDLLSTNNGGGFGFGWSKGSSSKYLTNQIMQTAKINQGNSALKRVVESIANGDSHVPFRDSKLTMLLQDSFEDDKSKIL # MILCASPDPKELHKTISTLEYGAKAKCIVRGPHTPLKEKGAEDSSSAVILGSRIAAMDQFIYKLQMENKLKEKECNEAKRKLMKKEEEIATLRSKLEV # VVAQGGVETTEEDIIVKVNERTQMLKHEFENKIQQCQETANEFVETERRKMEERMFQQQQEFEMLRRRLEEIESELWHSRVGSRSTEVEENSFGKRLL # EMYSEDAGMVKSMDLDRSIDMDCGKKAESNIIQAMLGYPSITNAREIEDPSILLQHFTNKSFLSTVFEEEEEGNDSEGDKENPYVEEVQKEVIEEKTI # CSDNVSRVEDRSDDLSSDNTAPSRKELIQNIFKLCGNSRELSQQCITTPSVPAEKRVKDTESKSPPVKEIVENSPITKNHNFSTEKVNDSKENFNPNS # ELKWEAASKENPMIITTLTDRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 20 # CDS exons: 1/3 # E: 1 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U331875) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 72737 73897 1 + . ID=g13 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 72737 73897 . + . ID=g13.t1;Parent=g13 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 72737 72739 . + 0 Parent=g13.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 72737 73897 . + 0 ID=g13.t1.cds;Parent=g13.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 73895 73897 . + 0 Parent=g13.t1 # protein sequence = [MTIYLKINKTVALRVKESDSIGNIKSLLHDNEGIPECLQHLFSKGVELADELKLVDYGITTNSFLHASVDNSISRIFF # VKRPYAIDAITVCSRICDTIQDVKYRIEASEGVESTEFSLIHDGKFLDDDKTFAFYKIDSGSMLHMVLYPRDKFLISIVMPWEKIVKIEVKAALTVRE # VKRSLESKVRWPKNSMYLFSGNQKLEDSKTLYQCDINEESIIQVKYRTIQIFINTGDGSTTLDVHRHELIRNVKLMILKKLKIPVHLQKLFYGGKCLF # DHRDLASYNVKKESNIMFDIRLPPPANIYERYEPYFTSSQPVSNMRCHHQTSLRKIKGVVSRFTSVAHLKTLIKYDLKVNVKELYLRGKLLSDLCCLG # KYGITKKTELGILC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 76393 79150 1 - . ID=g14 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 76393 79150 . - . ID=g14.t1;Parent=g14 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 76393 76395 . - 0 Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 76393 76714 . - 1 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 77001 77221 . - 0 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 77331 77443 . - 2 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 77574 78168 . - 0 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 78274 78456 . - 0 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 78566 78730 . - 0 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 78887 79150 . - 0 ID=g14.t1.cds;Parent=g14.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 79148 79150 . - 0 Parent=g14.t1 # protein sequence = [MMRGRSDGAQKKRLWTFVGIGTVLVVFLYMYFGSKSGGESALEYGSRSLRKLGSSYLGGDDNSDLSSRQEEKFGLEDG # DGGIVPKSFPVCDDRHSELIPCLDRHLIYQMRLKLDLSLMEHYERHCPLPERRYNCLIPPPPGYKVPIKWPRSRDEVWKLNIPHTHLANEKSDQNWMV # VKGEKIVFPGGGTHFHYGADKYIALIANMLNFTNNNLNDEGRIRTVFDVGCGVASFGGYLLSSDIIAMSLAPNDVHQNQIQFALERGIPAYLGVLGTK # RLPYPSRSFEFSHCSRCRIDWLQRDGILLLELDRVLRPGGYFAYSSPEAYAQDEEDLRIWREMSTLVERMCWRIAAKKNQTVIWQKPLNNDCYMERPP # GTQPPLCRSDNDPDAVWGVNMEACITPYSEHDHKVSGSGLAPWPARLSSPPPRLADFGYSNEMFEKDTDTWRERVDHYWSLLSSKISSDTLRNIMDMK # ANLGSFAASLKDKNVWVMNVVPKDGPNTLKIVYDRGLIGTTHDWCEAFSTYPRTYDLLHAWTVFSDAEKKGCSGEDLLLEIDRILRPTGFVIIRDKQH # IIEFIKKHLSALHWEAVASTDSTSDPEQDNDEVVFVVQKKLWLTSGSIRDTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 92.3 # CDS exons: 7/7 # E: 7 # CDS introns: 5/6 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U335099,SGN-U315339,SGN-U325489) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 83551 96306 1 + . ID=g15 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 83551 96306 . + . ID=g15.t1;Parent=g15 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 83551 83553 . + 0 Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 83551 83598 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 88216 89966 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 90216 90285 . + 1 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 90455 90601 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 91065 91319 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 93570 93855 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 94552 94817 . + 2 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 95141 95623 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 95917 96306 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 96304 96306 . + 0 Parent=g15.t1 # protein sequence = [MADPASYGNPDRDIDQLQNSTPCGASLDFSQTVSRDWTSADPYGYETSSNARSSDVGSERGNMQVRTSSDGFRISVSS # TPSCSSGGSGPDDIESLGDVYVWGEIWCDGVLKDGAGNPIPVKHDVLTPKPLESNVVLDVHQIACGVRHVALVTRQGEVFTWGEESGGRLGHGVEKDF # SRPKLVEFLAVTNVDFVSCGEFHTCAVSTMGDLYTWGDGTHNAGLLGHGNDVSHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGTYGA # LGHGDRVTVPYPKEVQSLYGLKTIKVACGVWHTAAIVEVTNHNCGNLPTRKLFTWGDGDKYRLGHGNKEAYMLPTCVSALIDYNFHQLACGHNITVGL # TTSGHVFIMGSNAYGQLGNPQADGKAPSLVQDRLVGEFVEEITCGSFHVAVLTSRSEVFTWGKGANGRLGHGDTEDRNSPTLIEALKDRHVKNIVCGS # NYTASICIHKWVSGADQSVCSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDSCYMKLKKASEGNSSLFVKKFNSSHRPIE # NSKLGRGEAKISRVLLSPTIEPIKYLEVKSMRGVIDSLRKTNDVLHQEVAKLQNQIKSLKQKSDGQDAELRKLKESSQESSRLVAERASKCNVAVETM # KSITIQLKEMTQELPPDISESPAIKSIHAQVESFLNTFGNQASEDNSSLQPDTSYSHQKPTHRNNISESVIRNDHWDAAGIPETSHSVDGTISFAQIF # ERQQIWQRLQHQQQHRALRSKTECQIERLNAQEPNRRFESEAGVVEFWDATQEQFECAGVQAVRHEIRRNGLLLPYYSNTPQLIYIVQGSGVHSTIFP # GCAETFETESPLDRRAQSGDRGQRSLDRHQKVRRFRAGDILALPAGVTHWTYNDGEEPIISVSLIDTSNVANQLDLTFRKFFLAGNPQRGVQQQVLGR # QQETTSQYGRRGSEQEKGGNMLSGFDPQVLSEAFNVDVEVIRKIQEEAPERGVIVLAENLRFLLPEEKEEEEEEREWHSRRGFPLNGLEETFCTMKLR # ENIGHPTRSDVYNPRGGRISTVNSNSLPVLNWLQLSAERGTLYNNAIVAPHWNLNAHSIIYIIRGSGRFQVVGNAGKSVFDDQVRQGQLIVVPQNFAI # VKKAGEQGLDYIAFKTNDNAMISPLAGRLSAIRAMPEEVLMNSYQISRQEAKSLKFNRDELSVFGPGARSSRQYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 35.3 # CDS exons: 3/9 # E: 3 # CDS introns: 3/8 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U314435,SGN-U312842) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 96844 104271 1 - . ID=g16 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 96844 104271 . - . ID=g16.t1;Parent=g16 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 96844 96846 . - 0 Parent=g16.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 96844 97336 . - 1 ID=g16.t1.cds;Parent=g16.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 97880 98009 . - 2 ID=g16.t1.cds;Parent=g16.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 103437 104271 . - 0 ID=g16.t1.cds;Parent=g16.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 104269 104271 . - 0 Parent=g16.t1 # protein sequence = [MQGFGILFSGIVALITAAGFDHAYRSPTFEENAALSTVPQSDYIWRIILMFGSLPAALTYYWRMKMPETARYTALVAK # DAKRAAQDMGKVLQVEIESEEAKIEQISRNETNQFGLFSWEFVRRHGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIAR # AQTLIALCSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEANRIGFIVMYSLTFFFANFGPNATTFVVPAEIFPARLRSTCHGI # SAAAGLLRCGKSCRLRWMNYLSPHIKRGNFTKEEEDNIINLHEILGNRWSAIAARLPGRTDNEIKNIWHTHLKKRLKNCQSPRSFKRHKKINQINNCM # HAPNSPEISSSETSIMTTNSSSSGTFDTTIDDQIVIKQEEMDSSEYFAKIDESFWTDELTIENNFDFVTNMDGEEFESLDMFNSTTIMEDDIDMDFLF # NFFIKTEEFSELPEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 60 # CDS exons: 2/3 # E: 2 # CDS introns: 1/2 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U325449) ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 107380 117371 1 - . ID=g17 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 107380 117371 . - . ID=g17.t1;Parent=g17 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 107380 107382 . - 0 Parent=g17.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 107380 107451 . - 0 ID=g17.t1.cds;Parent=g17.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 114024 114183 . - 1 ID=g17.t1.cds;Parent=g17.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 117352 117371 . - 0 ID=g17.t1.cds;Parent=g17.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 117369 117371 . - 0 Parent=g17.t1 # protein sequence = [MMVADKGEDEATFDLCNDAHAQRSDENSEEDEPSEDDGESKVIESESDEDIGDLPQNESASSSSPVSEFKIRSTSDFR # PVFGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 117427 118488 1 + . ID=g18 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 117427 118488 . + . ID=g18.t1;Parent=g18 C04HBa0207A03.1 AUGUSTUS_tom_ugs start_codon 117427 117429 . + 0 Parent=g18.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 117427 118488 . + 0 ID=g18.t1.cds;Parent=g18.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 118486 118488 . + 0 Parent=g18.t1 # protein sequence = [MQGFGILFSGIVALITAAGFDHAYRSPTFEENAALSTVPQSDYIWRIILMFGSLPAALTYYWRMKMPETARYTALVAK # DAKRAAQDMGKVLQVEIESEEAKIEQISRNETNQFGLFSWEFVRRHGLHLFGTCSTWFLLDIAFYSQNLFQKDVFSAVGWIPKAPTMNAVQEVYKIAR # AQTLIALCSTVPGYWFTVAFIDIIGRFAIQLMGFFFMTVFMFAIAIPYHHWTLEANRIGFIVMYSLTFFFANFGPNATTFVVPAEIFPARLRSTCHGI # SAAAGKAGAIVGAYGFLYAAQSKDPNKTDAGYPAGIGIKNSLIVLGCINALGMLCTFCVPEPKGKSLEEASQETITGEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04HBa0207A03.1 AUGUSTUS_tom_ugs gene 128590 128655 1 - . ID=g19 C04HBa0207A03.1 AUGUSTUS_tom_ugs transcript 128590 128655 . - . ID=g19.t1;Parent=g19 C04HBa0207A03.1 AUGUSTUS_tom_ugs stop_codon 128590 128592 . - 0 Parent=g19.t1 C04HBa0207A03.1 AUGUSTUS_tom_ugs CDS 128590 128655 . - 0 ID=g19.t1.cds;Parent=g19.t1 # protein sequence = [LLSFNFIYIYIYIYIYIYIFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 50 # CDS exons: 1/1 # E: 1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 10 # E: 10 (SGN-U344400,SGN-U342626,SGN-U318232,SGN-U325876,SGN-U319881,SGN-U316489,SGN-U313546,...) # incompatible hint groups: 0 ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C04HBa0207A03-OjpQJ/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C04HBa0207A03-OjpQJ/AUGUSTUS_tom_ugs/seq_with_defline_removed