##gff-version 3
# This output was generated with AUGUSTUS (version 2.0.2).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de).
# Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and
# a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225
# reading in the file /tmp/bac-submission-temp-C04HBa0304N09-Qp0AW/AUGUSTUS_tom_ugs/hints.gff ...
# Sources of extrinsic information: M E 
# Have extrinsic information about 1 sequences (in the specified range). 
# Initialising the parameters ...
# human version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C04HBa0304N09-Qp0AW/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format.
# We have hints for 1 sequence and for 1 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 121047, name = C04HBa0304N09.1) -----
#
# Constraints/Hints:
# Predicted genes for sequence number 1 on both strands
###
C04HBa0304N09.1	AUGUSTUS_tom_ugs	gene	13129	13500	1	+	.	ID=g1
C04HBa0304N09.1	AUGUSTUS_tom_ugs	transcript	13129	13500	.	+	.	ID=g1.t1;Parent=g1
C04HBa0304N09.1	AUGUSTUS_tom_ugs	CDS	13129	13500	.	+	0	ID=g1.t1.cds;Parent=g1.t1
C04HBa0304N09.1	AUGUSTUS_tom_ugs	stop_codon	13498	13500	.	+	0	Parent=g1.t1
# protein sequence = [TPDNYDSGEVQVASPPITSDNVATPDVLIDDKSIMDLSSTISDVEDQVEFDDPYINIETPAANFEYASSSDEQVALKG
# PTNNHHQTTTLVYVLVDLQLDNATLKSTILVNVQLRYFLHNKGII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
###
###
C04HBa0304N09.1	AUGUSTUS_tom_ugs	gene	30575	31235	1	+	.	ID=g2
C04HBa0304N09.1	AUGUSTUS_tom_ugs	transcript	30575	31235	.	+	.	ID=g2.t1;Parent=g2
C04HBa0304N09.1	AUGUSTUS_tom_ugs	start_codon	30575	30577	.	+	0	Parent=g2.t1
C04HBa0304N09.1	AUGUSTUS_tom_ugs	CDS	30575	30714	.	+	0	ID=g2.t1.cds;Parent=g2.t1
C04HBa0304N09.1	AUGUSTUS_tom_ugs	CDS	31160	31235	.	+	1	ID=g2.t1.cds;Parent=g2.t1
C04HBa0304N09.1	AUGUSTUS_tom_ugs	stop_codon	31233	31235	.	+	0	Parent=g2.t1
# protein sequence = [MVNLMIRQVNSLKSEVNSSNNELAVTVQTSYSNLPWNVECSYNTFCESQIQKGNHQRKRLQEGKYLLEVAK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
###
# command line:
# /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C04HBa0304N09-Qp0AW/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C04HBa0304N09-Qp0AW/AUGUSTUS_tom_ugs/seq_with_defline_removed