##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C04SLm0059M16-AUkGW/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C04SLm0059M16-AUkGW/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 131476, name = C04SLm0059M16.1) ----- # # Set orientation to reverse for hint group HintGroup SGN-U322190, 753-2262, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U337549, 1083-2246, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U318783, 2679-7945, priority= 4 15 features # Set orientation to reverse for hint group HintGroup SGN-U318784, 3098-5776, priority= 4 9 features # Set orientation to reverse for hint group HintGroup SGN-U315798, 9247-12718, priority= 4 11 features # Set orientation to reverse for hint group HintGroup SGN-U335328, 11678-12697, priority= 4 5 features # Delete group HintGroup SGN-U313888, 13833-15466, priority= 4 9 features # Set orientation to reverse for hint group HintGroup SGN-U313887, 18410-19019, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U341765, 21415-22314, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U327241, 29894-39395, priority= 4 19 features # Set orientation to forward for hint group HintGroup SGN-U326141, 48521-49250, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U323897, 49591-51519, priority= 4 15 features # Set orientation to reverse for hint group HintGroup SGN-U339112, 64819-65676, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U314841, 65371-70638, priority= 4 35 features # Delete group HintGroup SGN-U333669, 71451-73295, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U312565, 71461-73760, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U329561, 74721-79212, priority= 4 20 features # Set orientation to forward for hint group HintGroup SGN-U319612, 82663-91497, priority= 4 11 features # Delete group HintGroup SGN-U324900, 107163-111056, priority= 4 11 features # Set orientation to forward for hint group HintGroup SGN-U342863, 123336-124276, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U328858, 124263-127421, priority= 4 7 features # Forced unstranded hint group to the only possible strand for 18 groups. # Deleted 3 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 745 2217 1 - . ID=g1 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 745 2217 . - . ID=g1.t1;Parent=g1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 745 1116 . - 0 ID=g1.t1.cds;Parent=g1.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 1447 1871 . - 2 ID=g1.t1.cds;Parent=g1.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 1983 2217 . - 0 ID=g1.t1.cds;Parent=g1.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 2215 2217 . - 0 Parent=g1.t1 # protein sequence = [MPESGEIKSQAAKSDPQTTSPPPSQQPQTAALPLKRPQQLESSPNPTTPSVTDPKDVTPTTISSRITEPDFIYIPSYS # RWFSWNSIHECEVRFLPEFFDGRSPSKNPKTYKYYRNTIIRRFRDNPTKKITFTEARKTIVGDVGSIRRVFDFSETWGLINYTANSSKSLIKWEEKES # KSTSASAPQNADANGTSTDFTLPKKRICNLCKTVCRIACFASDKYDLTLCARCYVSNDNRVGVNNSELRRVEISEEVKTDWTDKETLHLLEALMHYGD # DWKKVAEHVGGRSTKECVARFVKLPFGEQFMGPPESAEMDSESRSETMYLQSKRRRLTPFADTSNPIIAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 83.3 # CDS exons: 3/3 # E: 3 # CDS introns: 2/3 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U322190,SGN-U337549) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 4261 7913 1 - . ID=g2 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 4261 7913 . - . ID=g2.t1;Parent=g2 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 4261 4263 . - 0 Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 4261 4283 . - 2 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 4434 4502 . - 2 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 4841 5078 . - 0 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 5210 5246 . - 1 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 5742 5871 . - 2 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 7246 7369 . - 0 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 7677 7913 . - 0 ID=g2.t1.cds;Parent=g2.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 7911 7913 . - 0 Parent=g2.t1 # protein sequence = [MAYQQQPPAQGSGSSAAGSGVPFFNSPFGDTTFTKVFVGGLAWETQSDTLRRFFEQFGEILEAVVITDKNTGRSKGYG # FVTFRDPESTRRACADPAPIIDGRRANCNLASLGRPRPSVQFGRLRSPTPFPAGLPAARGAYAGSFGYQQPVSYGYQQGLMYSPYGYATYGTDYVYPQ # GVYNPYGGQQYLPIYGVPGTVNATMYPYGQLSQAVPGSHSYTTLQGYAVPGHQILQFGGPGVNAMTASSIPTIQAPYQTGVGAPVTPQPQFILPTHSP # QFMQGTRLQQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 84.6 # CDS exons: 6/7 # E: 6 # CDS introns: 5/6 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U318783,SGN-U318784,SGN-U346815) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 9380 17358 1 - . ID=g3 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 9380 17358 . - . ID=g3.t1;Parent=g3 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 9380 9382 . - 0 Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 9380 9512 . - 1 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 9938 10127 . - 2 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 11125 11287 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 11550 11735 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 12338 12507 . - 2 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 15106 15217 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 15602 15811 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 16952 17017 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 17305 17358 . - 0 ID=g3.t1.cds;Parent=g3.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 17356 17358 . - 0 Parent=g3.t1 # protein sequence = [MSCMKILVFDEADHMLAESGFQDDSIRIMKAIVKASANCQVLLFSATFGENVKAFVTKIVQDLFVQDYNQMFVKKEEL # SLDSVKQYKVQCPDELSKIMVIKDRILELGQKVNLVVNYDLPVRHESPTEPDHEVYLHRIGRAGRFGRKADDKYAHLNNLDKAADNLKLFKADLLDPN # SLAGAIKGCDGVFHVASPVPSGSVPNPEVELVEPAVNGTLNVLKACYEENIKRVVFVSSVAASALDPNWPKGQVKDETCWSDGEFCKATDNWYCFSKT # VAEKEAWSYAKQSGLDLVTVLPTLVIGPMLQKTKNSSSLVLIKLLKEGYEELENKKRFLVDVRDLADALLLVYERPEAEGRYLCMAHAVKSEDLVAML # KKQYPNYNYPKRFTDVTEDGGFSSEKLQKLGWQYRALEETLVDAVESYKQKGFLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 52.9 # CDS exons: 5/9 # E: 5 # CDS introns: 4/8 # E: 4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U315798,SGN-U335327,SGN-U335328) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 21470 21926 1 + . ID=g4 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 21470 21926 . + . ID=g4.t1;Parent=g4 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 21470 21472 . + 0 Parent=g4.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 21470 21634 . + 0 ID=g4.t1.cds;Parent=g4.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 21716 21790 . + 0 ID=g4.t1.cds;Parent=g4.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 21873 21926 . + 0 ID=g4.t1.cds;Parent=g4.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 21924 21926 . + 0 Parent=g4.t1 # protein sequence = [MASDWRKSVGNVRSFVGNLTGGLRGGSNLASWVVAGTLAYFLWVKPSQELKRQQEEKAALAAASDAYRYVEKRKPVPD # PQETGLIYGNKNKAKRAEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U341765) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 28151 28510 1 + . ID=g5 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 28151 28510 . + . ID=g5.t1;Parent=g5 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 28151 28153 . + 0 Parent=g5.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 28151 28237 . + 0 ID=g5.t1.cds;Parent=g5.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 28346 28510 . + 0 ID=g5.t1.cds;Parent=g5.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 28508 28510 . + 0 Parent=g5.t1 # protein sequence = [MAASFANAVFERLPLEEDDEAPANVPTTQVQPAASQSSGVTGGGEAAGTAHPAEGNMAFGNNYSFSAELLGWGGNAAN # ERPPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 66.7 # CDS exons: 2/2 # E: 2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U342513,SGN-U327464) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 30192 41072 1 - . ID=g6 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 30192 41072 . - . ID=g6.t1;Parent=g6 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 30192 30194 . - 0 Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 30192 30284 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 30843 30935 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 31851 31901 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 31983 32049 . - 1 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 32520 32592 . - 2 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 32824 32875 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 32980 33102 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 34462 34551 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 35318 35363 . - 1 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 39367 39419 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 39921 39960 . - 1 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 40047 40201 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 40302 41072 . - 0 ID=g6.t1.cds;Parent=g6.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 41070 41072 . - 0 Parent=g6.t1 # protein sequence = [MDKTDVEMDDVQNTVVESIDSSPALPGQHSTSENAKIGTQNHPETGAKTPIPAENGNGDTMKQTDPKAAVEDHKNAAT # ETATIGQPETQGNTALDDQNNATGGTEGETTIQDKKEGDPDADVALKKEEPIGNVARHDTTGVNMQVLEELPTNEVGDSGKEVKEAHQAENSIKDVHQ # NGNDMMVDEQKKVEHKANTASVISDRDDRSNELSETKDAVKNTAIAKMPEPATPNLSVKCDTANTGQHTGEASNKIFDESKMADDEDEDEDWNDDGSP # EDQTAFMRELENFYRERAMEFKPPKFYGIPLNCLKLWRSVIRLGGYDRVTGSKLWRQVGESFNPPKTCTTVSWTFRIFYEKALLEYERHKMQSGKLQL # PIAALPEAGVDNEGNGNQTPGSGRARRDAAARAMQGWHEQRLLGCGEVGEPIVKDKNAKHTPKREKNFKSIGSIKHKRPNEMEHPSKVARTETSKQLV # TTVVDLGPPADWVKINVRETKDCFEIYALVPGLLREEVRVQSDPAGRLVITGQPEQLDNPWGITAFKKVVSLPARIDPLQTSAVVTLHGQLFVRVPFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 76 # CDS exons: 10/13 # E: 10 # CDS introns: 9/12 # E: 9 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U327241) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 49795 56083 1 - . ID=g7 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 49795 56083 . - . ID=g7.t1;Parent=g7 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 49795 49797 . - 0 Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 49795 49887 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 49971 50109 . - 1 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 50194 50263 . - 2 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 50382 50475 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 50568 50679 . - 1 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 50774 50835 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 50930 51071 . - 1 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 51261 51555 . - 2 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 52415 52553 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 54002 56083 . - 0 ID=g7.t1.cds;Parent=g7.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 56081 56083 . - 0 Parent=g7.t1 # protein sequence = [MESEPLILENEFDMCSAEEEDNLNASGVDLGQQCSSSDLEPYEGMEFESEQAARIFYNSYARRVGFGTRVSAYRRSRR # DNSISTRQLVCSKEGFNPRPDNGAQHKPKRQRIVSRVGCKAHLTVKKLTSGKWAITKFIKDHNHELVPPDQVHLIRSHRHVSGPARSLIDTLQAAGLG # ATGVMSVLIKQSGGLNNVGFTKVDCQNYMNQSRQRTLGSGAHYIFEYLKQKQSEDPDFFYAVQDGSSGNIFWADSTSRKNYSYFGDTVTFDTTYRTHR # YRVPFAPFIGVNHHCQPVLFGCALLLNESESSFIWLFENWLAAMSGCHPISITSDHDRIIRSAILDVFPGARHRFCKSNIFREAQERLSHSIQSFPTF # EAEFQKCVNLTETIAEFELCWGSLLGRYNLIDDEWLQSMYDARQQWVPVYLRDTFFGDTSIAKTSDSTSSFFDGYIDASTNIHILMSQYEKAIASRHE # KEVKAEYDTINIAPILKTPSPMEKQAANIYTREIFLMFQQELMETLAYPATSINDAGSDVIFQVVKFGEDHKVHYVQYNVVEKKASCSCQLFDFSGIL # CRHILAVFRVKNVLRLLSHYVLKRWTRKAKSEVLLDEDKLGLPSSHNDSFTDRFEKLSLEATNYVKEGVDSKSVYLVALDALCEASKKVAAAMCGTPA # QPLSQDMNKEKEFNLNGNQTDCDDPSLLSEDEKIKELTTAVVYATETCEAYRAKLLSILSEMEEQKLRISLKVQNAPSEKTPEAHKHKHSESEEMEAA # KNAGKSVSAMEAFEKLEKVGEGTYGKVYRARDRITGKIVALKKTRLHEDEEGVPPTTLREISLLRMLSRDPHIVRLMDVKQGQNKEGKTVLYLVFEYM # DTDVKKFIRTFRAKGETMPLKIVKSLMYQLCKGVAFCHGHGVLHRDLKPHNLLMDRKTNVLKLADFGLGRAYTLPIKKYTHEILTLWYRAPEVLLGAT # HYSTAVDMWSVGCIFAELVTNQALFPGDSELQQLLHIFRLLGTPNEELWPGVSKLVNWHEYPQWKPQPLSTVVPGLDEDGIHLLSEMLHYEPSRRISA # KKAMEHPYFDDLDKTPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 78.9 # CDS exons: 8/10 # E: 8 # CDS introns: 7/9 # E: 7 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U323897) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 58016 59764 1 - . ID=g8 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 58016 59764 . - . ID=g8.t1;Parent=g8 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 58016 58018 . - 0 Parent=g8.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 58016 58254 . - 2 ID=g8.t1.cds;Parent=g8.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 58447 58771 . - 0 ID=g8.t1.cds;Parent=g8.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 59198 59764 . - 0 ID=g8.t1.cds;Parent=g8.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 59762 59764 . - 0 Parent=g8.t1 # protein sequence = [MLQFSKRLASKGIKITVATTLSNAKSMKATLSYSMITFESIYDDCSQGGVLGPGGFKGFLDRFQASGSTNLTRFILDH # EHPVKCLVYDANIPWASKISTQLGIAGAAFFTQSCATAATYYPMYCEVYEKTPLSMLSFPVVTRLPKLRFPDLPSRTGRYPPIIIHILGQFDNFGKAD # WVLFNSFDKLEEEVVNWMKKVWNVVTIGPTLPSFYLDKRVENDNEYGFNIHKPNYSNCMEWLDSKKTGSVVYVSFGSAANLCAEQITELADALRQSNI # MFLWVVKPDEQSKLPSDFSKETSGLIAKANEDEKGVTASEEIYRCIREVLEGERGEEIRKNITSLKELAKEAIDTSGSSDKHIDDFISQLDPAYLRHR # SNYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U344418) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 61990 70594 1 - . ID=g9 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 61990 70594 . - . ID=g9.t1;Parent=g9 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 61990 61992 . - 0 Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 61990 64374 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 65011 65118 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 65218 65383 . - 1 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 65592 65695 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 65802 65918 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 65995 66099 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 66608 66664 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 66750 66794 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 66877 66987 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 67220 67293 . - 2 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 67375 67468 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 67574 67654 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 67866 67919 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 68374 68457 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 68613 68680 . - 2 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 68777 68890 . - 2 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 68976 69050 . - 2 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 69335 69447 . - 1 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 69784 69956 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 70505 70594 . - 0 ID=g9.t1.cds;Parent=g9.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 70592 70594 . - 0 Parent=g9.t1 # protein sequence = [MDADYGIARELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHTYGQPLAHFLRATAKVPDA # QIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNILLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAAC # KALKLDGLVIIGGVTSNTDAAHLAEKFAETKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICKVNSQLISNVCTDALSAEKYYYFIRLMGRKASHVAL # ECTLQSHPNMVILGEEVAASKLTIFDITQQICDAVQARAEHDKNHGVILLPEGLIESIPEIYALLQEIHGLLRQGVSADNISSQLSPWASALFEFLPH # FIRKQLLLHPESDDSAQLSQIETEKLIAHLVETEMNKRLKEGTYKGKKFNAICHFFGYQARGSLPSKFDCDYAYVLGHVCYHILAAGLNGYMATITNL # KNPANKWHCGAAPISAMMTVKRYGRGPGKASIGVPALHPATVDLRGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAVTLCVEDQDYIGRIKK # LQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSVISSPSSNQSATSSIANFYAVQLQLLCREHKHATSASALLRSIHANMITSGFRPRSHILNSL # INIYCKNSGLVYAKHLFDRIPQPDVVARTTMIAAYSASGEPKLAREIFDKTPLSFRDTVCYNAMITGYSHNNHGHAAIKLFLDMRWKNFQPDEYTYTS # VLAALALIADHEMHCRQMHCAVAKSGMANFKCVVNALICVYVRCASSPLASSLLLMDSASKLFYEMPERDDLSWTTIITGYVKNDDLDAARKVFDGMD # EKLLVAWNAMISGYVHKGFIFEALDMLRKMYLAGMKPDEFTCTSILSACADAGLFLLGKQVHAYVKRTEEKIHVSVYNALITLYWKCGRVDDARKVFD # NLVFKDIVSWNAVLSAYVSAGRISEAKLFFDEMPEKNSLAWTVMISGLAQNGLGEDGLKLFNQMRVKGIELCDYAFAGAITSCAVLGALETGCQLHAQ # LIQRGYDSSLSAGNALVTFYGRSGVIEAARNVFLTMPCVDLVSWNALVAALGQHGYGVQAVGLFEQMLDENIMPDRISFLTVISACSHAGLVEKGRHY # FNIMHSVYKIIPGEDHYARLVDLLSRAGRLLEAKEVIQNMPYKPKAPIWEALLAGCRTHRNVDLGVEAAEQLFELTPQHDGTYILLANTFAAAGRWDD # AAKVRKLMRDQGVKKEPGCSWIKVENTVHVFLVGDTAHPEIQVVYNYLEELRLKMRKMGFVPDTQYVLHDMETEQKEYALSTHSEKLAVVFGLLKLPR # GATIRVFKNLRICGDCHNAFKFMSKVEAREIIVRDGNRFHHFRDGECSCGNYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 92.3 # CDS exons: 18/20 # E: 18 # CDS introns: 18/19 # E: 18 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U339112,SGN-U314841) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 71623 73617 1 - . ID=g10 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 71623 73617 . - . ID=g10.t1;Parent=g10 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 71623 71625 . - 0 Parent=g10.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 71623 71870 . - 2 ID=g10.t1.cds;Parent=g10.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 72086 72309 . - 1 ID=g10.t1.cds;Parent=g10.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 73235 73617 . - 0 ID=g10.t1.cds;Parent=g10.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 73615 73617 . - 0 Parent=g10.t1 # protein sequence = [MIDNIDDIINWDDVDHIFHNVLDNPDDDQFTLHDSSPQSFQQIEQLLMNDDDFGLVSDPQFAAESLSDFLVDSPLHSD # HSHSPAEQAIGFSDPKVSSADQDKHKVSQSPSDGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKRLGFVLQCCLAENQ # ALRFSLHNSSANGVSMTKQESAVLFLESLLLGSLLWFLGITCLLILPSQTWSVPEESQGSRNHGLLVPIKEGKKTSRILLFLSFMMSKRCKASRSRMK # LNPHPLGVVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U312565,SGN-U333668) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 74963 79089 1 - . ID=g11 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 74963 79089 . - . ID=g11.t1;Parent=g11 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 74963 74965 . - 0 Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 74963 75026 . - 1 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 75097 75177 . - 1 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 75339 75427 . - 0 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 75524 75692 . - 1 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 76039 76093 . - 2 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 76165 76231 . - 0 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 76305 76386 . - 1 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 78135 78292 . - 0 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 78387 78531 . - 1 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 78655 78714 . - 1 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 78890 79089 . - 0 ID=g11.t1.cds;Parent=g11.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 79087 79089 . - 0 Parent=g11.t1 # protein sequence = [MEKVGGDYVLDKEAEFLASKQETGHEWELFKENVRPLKRGRNVNLLNNALKSSTDYQLKKSLLDKRREFIEAIDKYKG # EDPLHPWLQCIKWVQEAFPPGGDSSGLIVIYEQCVRTFWHDELYKNDLRYLKVWLEYAENCMDAEVIYSFLEANKIGLTHSSFYIAYALHMESQNKIK # TANEIFNRGLSMNAEPEEKLKVSYKKFFSRSMGRPKAAEEEITEHQLPMRSFGTLLARGEARNQTTGTSELSRKKMKPDRAQGSLFSIYKDANAGMSS # TLQSEIPKLENTSWHCLGARADRNKENQAIPSKWTSNKIPQRHGLRNRGATTTTTPCLEIFVDEECAKAQEKDSAAGVKASSLQLRRGDDKDIKKETE # LLRENPLRYFPPSSLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 95.2 # CDS exons: 11/11 # E: 11 # CDS introns: 9/10 # E: 9 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U329561) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 81481 91218 1 + . ID=g12 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 81481 91218 . + . ID=g12.t1;Parent=g12 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 81481 81483 . + 0 Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 81481 81639 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 82664 82762 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 82828 82994 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 83137 83283 . + 1 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 83895 84027 . + 1 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 84759 84851 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 90916 91218 . + 0 ID=g12.t1.cds;Parent=g12.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 91216 91218 . + 0 Parent=g12.t1 # protein sequence = [MMMMSGSAGVPKYKGTQMREKQLTEMIEKKVKEAKEVCSEDARSDECKVAWDELPHLSSSVPKDQRLYRNASALDPFS # RHKASWQELAGVLVFSAIPFTAVKAIANSTFGETLRKRLEERKKVAVENSAKFKALALMARNDSIWYGEDRPRWLGPISYDYPAYLNGELPGDYGFDI # CGLSKDPVALQNYFNYEILHGRWAMLAALGALIPELLNLTGLFQFVEPVWWRVGYSKLKGDTLDYLGIPGLHLAGSQGVIVIAICQALLMVGPEYARY # CGIEALEPLGIYLPGDINYPGGVLFDPLNLSKDPMAFEELKVKEIKNGRLAMVAWLGFYVQAALTGKGPVQNLLEHISDPFHNNLLSILKSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 84.6 # CDS exons: 6/7 # E: 6 # CDS introns: 5/6 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U324311,SGN-U319612,SGN-U345730) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 91758 92162 1 - . ID=g13 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 91758 92162 . - . ID=g13.t1;Parent=g13 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 91758 91760 . - 0 Parent=g13.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 91758 92162 . - 0 ID=g13.t1.cds;Parent=g13.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 92160 92162 . - 0 Parent=g13.t1 # protein sequence = [MLSTEIKFPNHPHLLKVLPQGNTLTGGAGGGNDQPGMVCSECKKKRSSGRVYSCTVCDYHLHALCAKSMINGLQEYGI # KPPEKPTMLGTAARLASQVVIEFIGGLIEGFGEGVGEVLVQNIGRGRRSTNRRRIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 94484 96282 1 + . ID=g14 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 94484 96282 . + . ID=g14.t1;Parent=g14 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 94484 94486 . + 0 Parent=g14.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 94484 95463 . + 0 ID=g14.t1.cds;Parent=g14.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 95916 96282 . + 1 ID=g14.t1.cds;Parent=g14.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 96280 96282 . + 0 Parent=g14.t1 # protein sequence = [MAKTPSNLVVTLLAFTLVMLIWNLQPYYDTILNPPASSNITDPNKRTFITYGNAASLFVQMGAYRGGPTTFAVVGLAS # KPLHVFGRPWYKCEWIPNTNTNSSKAKAYKILPDWGYGRVYTVVVVNCTFTVNPNLDNNGGKLILYAYYSESPKRYEKITALEEAPGSYNQSKFSPPY # TYEYLYCGSSLYGNLSASRMREWMAYHAWFFGPSSHFVFHDAGGVSSEVRAVLEPWVQAGRVTLQDIRDQSEFDGYYYNQFLVVNDCLHRYRHSAYWT # FYFDVDEYIYLPDANTTLESVLRDFSNNTQFTIEQNAMSSILCLNNSSQNYSRLWGFEKLLFRDSRSNIRRDRKYAIQAKNAYATGVHMSENVVGGTL # HQTETKIRYYHYHNSITVHEELCREFLPMSAKHNITWFDKVPYEYDDSMKKLTQTIKDFERNTININAAPDHTNNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 66.7 # CDS exons: 2/2 # E: 2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U327877) # incompatible hint groups: 1 # E: 1 (SGN-U330546) ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 122200 127913 1 + . ID=g15 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 122200 127913 . + . ID=g15.t1;Parent=g15 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 122200 122202 . + 0 Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 122200 122265 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 123327 123378 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 123739 124112 . + 2 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 124196 124290 . + 0 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 125957 126199 . + 1 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 126393 127036 . + 1 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 127304 127507 . + 2 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 127903 127913 . + 2 ID=g15.t1.cds;Parent=g15.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 127911 127913 . + 0 Parent=g15.t1 # protein sequence = [MEKAKELCSVESESTFEFARSVAGNADDAIEECKYLESKGLLDVESLQLYALSYWKLGKYDLALSMAKRLASSALPTE # HPLAAASVSFICRLVYHISGKELAIRNILQLPKRAFQSSRVRLVAFAIHALDESHQLDSVVSCVRESLSSNKEIAALDFLATLGLLVKHGSKDCLEVQ # KGVNYLRRALHTSPNSHLIRTLLGYLLVSSREWKDVHISARCFRVDPSEHQKKEGVKSSVQIFGAGAVACCNVGSGKKTLAMSICRENSTLECKTIKL # LQKCVHQEPWDHHSYYLLVLNYLQKAREKKFPRNLCVVLERLINVALRSELYAKDDISSQYQKFQLLLCAAEVSLHGGNNFKCIMHAKSTLEMQLPDN # YLFFAHLLLCRAYAVEDNYSGLHEEYIRCLQLKTDNHIGWICLKFLESRYKLQSDSSSLALAFQECGKEIKTSWNMWIAMYNLVQGLTAAWNGEFIDA # EESIAQACLLAGGESCLFLSHGVICMEIARQQSDSDFLSLAIRSLKKAKDSSSTPLPFVSLLLAQAEASFGSESKWEKNLIEEWSSWRPGQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 73.3 # CDS exons: 6/8 # E: 6 # CDS introns: 5/7 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 3 # E: 3 (SGN-U342863,SGN-U328858,SGN-U331473) # incompatible hint groups: 0 ### ### C04SLm0059M16.1 AUGUSTUS_tom_ugs gene 129471 130408 1 - . ID=g16 C04SLm0059M16.1 AUGUSTUS_tom_ugs transcript 129471 130408 . - . ID=g16.t1;Parent=g16 C04SLm0059M16.1 AUGUSTUS_tom_ugs stop_codon 129471 129473 . - 0 Parent=g16.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 129471 129578 . - 0 ID=g16.t1.cds;Parent=g16.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 129706 129899 . - 2 ID=g16.t1.cds;Parent=g16.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs CDS 130396 130408 . - 0 ID=g16.t1.cds;Parent=g16.t1 C04SLm0059M16.1 AUGUSTUS_tom_ugs start_codon 130406 130408 . - 0 Parent=g16.t1 # protein sequence = [MSSPDTVIASSPGKEVHNPWAFYLHAALLRQAFAHCGKFPTATSCRSLGRVSVPVWLIILSDQLLIIALVLTRYSPVR # HWKHRFPCSPSDLHEKIDSVKDEISK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 20 # CDS exons: 1/3 # E: 1 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U326960) # incompatible hint groups: 1 # E: 1 (SGN-U343906) ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C04SLm0059M16-AUkGW/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C04SLm0059M16-AUkGW/AUGUSTUS_tom_ugs/seq_with_defline_removed