##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C09SLm0058A04-I962s/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C09SLm0058A04-I962s/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 96875, name = C09SLm0058A04.1) ----- # # Set orientation to reverse for hint group HintGroup SGN-U342195, 10306-11263, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U331270, 11803-13715, priority= 4 9 features # Set orientation to reverse for hint group HintGroup SGN-U321459, 17988-20129, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U321460, 17997-20085, priority= 4 6 features # Set orientation to reverse for hint group HintGroup SGN-U314761, 20051-23357, priority= 4 19 features # Set orientation to reverse for hint group HintGroup SGN-U338695, 20246-21561, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U343694, 25555-26416, priority= 4 7 features # Delete group HintGroup SGN-U339849, 26751-30470, priority= 4 10 features # Set orientation to reverse for hint group HintGroup SGN-U333212, 40666-41879, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U316460, 42706-53357, priority= 4 19 features # Set orientation to reverse for hint group HintGroup SGN-U335681, 43221-43994, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U316459, 46217-54248, priority= 4 15 features # Set orientation to reverse for hint group HintGroup SGN-U335683, 46332-50062, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U335684, 46350-52956, priority= 4 13 features # Set orientation to reverse for hint group HintGroup SGN-U335680, 51735-54239, priority= 4 7 features # Set orientation to forward for hint group HintGroup SGN-U312838, 55713-57250, priority= 4 5 features # Delete group HintGroup SGN-U333960, 55875-56355, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U333961, 56109-57093, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U333962, 56240-57055, priority= 4 4 features # Delete group HintGroup SGN-U320039, 57064-63395, priority= 4 15 features # Set orientation to reverse for hint group HintGroup SGN-U327064, 63512-66229, priority= 4 11 features # Set orientation to reverse for hint group HintGroup SGN-U322247, 66873-77630, priority= 4 15 features # Set orientation to reverse for hint group HintGroup SGN-U322248, 67589-77732, priority= 4 17 features # Delete group HintGroup SGN-U346700, 82063-82653, priority= 4 3 features # Delete group HintGroup SGN-U313104, 82147-85141, priority= 4 8 features # Delete group HintGroup SGN-U313107, 82375-87428, priority= 4 8 features # Delete group HintGroup SGN-U334145, 82528-87417, priority= 4 12 features # Delete group HintGroup SGN-U313106, 82656-87373, priority= 4 4 features # Delete group HintGroup SGN-U313101, 84993-87348, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U313102, 86575-86921, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U324147, 88039-92742, priority= 4 13 features # Forced unstranded hint group to the only possible strand for 22 groups. # Deleted 9 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 397 1526 1 + . ID=g1 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 397 1526 . + . ID=g1.t1;Parent=g1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 397 573 . + 0 ID=g1.t1.cds;Parent=g1.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 653 751 . + 0 ID=g1.t1.cds;Parent=g1.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 1191 1526 . + 0 ID=g1.t1.cds;Parent=g1.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 1524 1526 . + 0 Parent=g1.t1 # protein sequence = [INEVRKLIGPALNKFPTMCSDASILRFLRARNWHTKRSAKMLKEALIWRLENKPNMIRWDDIAKQAEPGKVYKANYFD # KYGRTVLVMKPGIPLVKPFLEKRTYKKVKFVYPNDVDTQKVMEDLFDMEKLESCFGGKWTHDFDYVTYSNRMREGDKMMTDFVISGAPLPSDQFQLST # DETTSNFKTSHDTSENHPNIDDIKQTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 4 # E: 4 (SGN-U335133,SGN-U340739,SGN-U316489,SGN-U323351) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 2331 2858 1 + . ID=g2 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 2331 2858 . + . ID=g2.t1;Parent=g2 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 2331 2333 . + 0 Parent=g2.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 2331 2368 . + 0 ID=g2.t1.cds;Parent=g2.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 2525 2858 . + 1 ID=g2.t1.cds;Parent=g2.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 2856 2858 . + 0 Parent=g2.t1 # protein sequence = [MVSIAHENRRNEGHKDLLTATSTTIETDNDVGIRITQKWFAIAHENHRNEGYSRFGARLNFKMSRTGREGKSDAYKMS # LRMSTKNLAFLTSEHENNRNEGYARFGARLTFQMGRKSRDGQPYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 10430 17130 1 - . ID=g3 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 10430 17130 . - . ID=g3.t1;Parent=g3 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 10430 10432 . - 0 Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 10430 10468 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 10559 10697 . - 1 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 10764 11008 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 11106 11427 . - 1 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 11708 11932 . - 1 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 12689 12855 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 12954 13070 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 13382 13555 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 13639 13734 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 14217 14307 . - 1 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 14531 14649 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 14827 14884 . - 1 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 15090 15241 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 17068 17130 . - 0 ID=g3.t1.cds;Parent=g3.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 17128 17130 . - 0 Parent=g3.t1 # protein sequence = [MHALEELHLCLVSTSTLQGLREAIVLPPFVAIAVRPRPGVWEYVRVNVYDLSVEQLTVPEYLRFKEELVDGDNESLDP # LLDFLRGHNHKGNVLMLNERIQRISRLESSLNKADDYLSKLPPDTPYTDFEYALPMVFNVVILSPHGYFGQANVLGLPDTGGQVVYILDQVRALEAEM # LLRIKQQGLNFKPRILVVTRLIPDAKGTTCNQRLERISGTEYSHILRVPFRTENGILHKWISRFDVWPYLEKFTEDVAGEMSAELQGVPDLIIGNYSD # GNLVASLLAYKMGITQCTIAHALEKTKYPDSDIYWKKFEEKYHFSCQFTADLLSMNHSDFIITSTYQEIAGTKNTVGQYESHTAFTLPGLYRVVHGID # VFDPKFNIVSPGADMTIYFPYFDKEKRLTSLHPSIEKLLFDPEQNEVHIGSLNDQSKPIIFSMARLDRVKNITGLVECYAKNATLRELANLVVVAGYN # DVKKSNDREEIAEIEKMHALMKEHNLDGQFRWISAQMNRARNGELYRYIADKRGIFVQPAYYEAFGLTVVEAMTCGLPTFATCHGGPMEIIQDGVSGY # HIDPYHPNKAAELMVEFFQRCEQNPTHWENISASGLQRILDRYTWKIYSERLMTLAGVYGFWKLVSKLERRETRRYLEMFYILKFRELVKSVPLAVDE # KQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 59.3 # CDS exons: 9/14 # E: 9 # CDS introns: 7/13 # E: 7 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U331270) # incompatible hint groups: 1 # E: 1 (SGN-U342195) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 18224 40295 1 - . ID=g4 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 18224 40295 . - . ID=g4.t1;Parent=g4 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 18224 18226 . - 0 Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 18224 18319 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 18402 18470 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 19174 19235 . - 2 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 19922 20378 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 20462 20548 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 21368 21439 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 21560 21646 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 21735 21866 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 21969 22127 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 22460 22561 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 22649 22705 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 23186 23248 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 23341 23401 . - 1 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 25211 25308 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 25501 25608 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 26092 26163 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 26244 26321 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 26396 26494 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 26620 26751 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 26831 26923 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 31712 31927 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 34678 34905 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 35238 35415 . - 1 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 40047 40205 . - 1 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 40285 40295 . - 0 ID=g4.t1.cds;Parent=g4.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 40293 40295 . - 0 Parent=g4.t1 # protein sequence = [MPFSRDDGISCEGENNVYEESDDDYSSIQRPAFKVTGEPDFDSGPPEDGLEYLRRVRWEALRLPKVKVAAVQGSKLNK # EQTSYMPQIPDISSCLEHLLPLKKWEEAFLADFSELRLALSRLEANIGSSRQLHSSTFVDKPHSSDQLPENIVLDKFDGLMSGEDESSISDAGDDPKS # SPANSPTLSVILGMDAKGTKASVPAKAEVQKAIQTLEVPTLSLDKMKEETDNFGSKALVGEGSHGRVYYTNLNNDKVVVVKKLDFLSQLAFEAHDGQK # RRSGEPFIIHPIAVAQILGQLELDWESVAAGLLHDTVEDTDVVTFERIEKEFGATVRRIVEGETKVSKLGKIKCKDESHVQDVKADDLRQMFLSMTEE # VRVIIVKLADRLHNMRTLSHMPPHKQSGIATETLQVFAPLAKLLGIYQIKSELENLAFMYTNAQDYARVQRRIAELHKEHEKELKEAKRILMKKIEED # QFLELVTVMTEIQSICKEPYSIYKAVLKSKSSIKEVNQIAQLRIIIKPKPCVGVRPLCSAQQICYHLLGLVHGIWTPIPRAMKDYIATPKPNGYQSLH # TTVIPFLYESMFRLEVQIRTEEMDLIAERGIAAHYSGKGFVNGLVGHVITNDKNSGGKIVCLNNANIALRIGWLNAIREWQEEFVGNMSSREFVDTIT # RDLLGSRVFVFTPGGEIKHLPKGATVIDYAYMIHTEIGNKMVAAKVNGNLIKPMHVLANAEVVEIITYNGLSSKSAFERHKQWLQHAKTRCARHKIMK # FLREQAALSASEITVDSVKEFAAESEGDSTVEKLADYSEGTKHSWEKILKNVMDVLSARMSGENIFQLRSGSIQIPKVNGKHNKCMQHTNLKATGETL # SQGNGVGEMILANIPRYRDVLPGLDGWMASKVATWQNLEGHSVQWFCVVSIDRKGMMADITSALAAVGVIICSCAAETDRGKGIGVALFHIEANLESL # VGASSRIDMILGVLGWSTGCSWSENKQFLEC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 65.3 # CDS exons: 17/25 # E: 17 # CDS introns: 15/24 # E: 15 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 3 # E: 3 (SGN-U314761,SGN-U338695,SGN-U343694) # incompatible hint groups: 3 # E: 3 (SGN-U321459,SGN-U321460,SGN-U328529) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 40738 53120 4 - . ID=g5 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 40738 41881 . - . ID=g5.t1;Parent=g5 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 40738 40740 . - 0 Parent=g5.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 40738 40841 . - 2 ID=g5.t1.cds;Parent=g5.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 41293 41881 . - 0 ID=g5.t1.cds;Parent=g5.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 41879 41881 . - 0 Parent=g5.t1 # protein sequence = [MADDFGSHASSEFSNTRVSENSKKLNVCASETQESNTHDESIKKNDEEKKDDGSVRCSLKIEVIDDTAMIDISQVGKS # CSIDKNFDGKSGRNRKKKNANQMVTVKAKDRKIEEKNVNGGCKINGGEEKRVYCRKELENLRFVGMEQQRKMWVELYCGLGDTVQKEYDGLVDSNTQK # HIRLSRSRRHIGKENTPVISGVLAAKERGKHMKVYTQRGMTYMNLQNTLCLPGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U333212) C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 42887 53120 . - . ID=g5.t2;Parent=g5 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 42887 42889 . - 0 Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 42887 43086 . - 2 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 43772 44023 . - 2 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 46079 46562 . - 0 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 46640 46846 . - 0 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 49654 49721 . - 2 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 49839 49904 . - 2 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52209 52290 . - 0 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52389 52441 . - 2 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52868 52967 . - 0 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 53109 53120 . - 0 ID=g5.t2.cds;Parent=g5.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 53118 53120 . - 0 Parent=g5.t2 # protein sequence = [MDYSMEQLLSPLVFNGSTVEAITEAKQKKKLFVVLVSGGNMESNQSETSTWLDPRVADSISKYCILLHILEGSTDARN # FSALYPQEAIPCITVIGYNGVQLWQHGGFVSAENLASSLEKAWLSLHVQDTTTTLLTAALASRKDLVSGASSVTAEVGSSSSAQVSPAQAITHIQSPL # ATLSKNSQIVEGEDPGHAAMDIDSSLIDMDSHGSADAFESRIGDFNESTTVITTAEKPLDLVEVDSNKGKDECSMSKENPGLRDQHLDPSDEAPREIA # NKAGKDPEINIVEDAAAESDDSSNIFHDVCLNIRLPDGSSLQVKFLVVDTLRMVKHYVDKNQTSSIGYYDLAVPYPRKVFGDEDLDRTLSDLGLHNRQ # ALIIVLRNKVDVTSLHGLNNPAESNHTTIGGDAGYFATIRKLFSYVNPLSYLGGSSNTSNTARDSIWQYGPNSSTPQNNQSLVSKTSTTNNRGRKRAS # SSFGSNIHTLKHDEDENQSGDKNTFWNGNSTQFGGDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 10/10 # E: 10 # CDS introns: 9/9 # E: 9 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 7 # E: 7 (SGN-U316460,SGN-U335681,SGN-U316459,SGN-U335683,SGN-U335684,SGN-U335596,SGN-U335680) C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 40738 53120 . - . ID=g5.t3;Parent=g5 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 40738 40740 . - 0 Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 40738 40841 . - 2 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 41293 41874 . - 2 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 46079 46562 . - 0 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 46640 46846 . - 0 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 49654 49721 . - 2 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 49839 49904 . - 2 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52209 52290 . - 0 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52389 52441 . - 2 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52868 52967 . - 0 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 53109 53120 . - 0 ID=g5.t3.cds;Parent=g5.t3 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 53118 53120 . - 0 Parent=g5.t3 # protein sequence = [MDYSMEQLLSPLVFNGSTVEAITEAKQKKKLFVVLVSGGNMESNQSETSTWLDPRVADSISKYCILLHILEGSTDARN # FSALYPQEAIPCITVIGYNGVQLWQHGGFVSAENLASSLEKAWLSLHVQDTTTTLLTAALASRKDLVSGASSVTAEVGSSSSAQVSPAQAITHIQSPL # ATLSKNSQIVEGEDPGHAAMDIDSSLIDMDSHGSADAFESRIGDFNESTTVITTAEKPLDLVEVDSNKGKDECSMSKENPGLRDQHLDPSDEAPREIA # NKAGKDPEINIVEDAAAESDDSSNIFHDVCLNIRLPDGSSLQVKFLVVDTLRMVKHYVDKNQTSSIGYYDLAVPYPRKVFGDEDDFGSHASSEFSNTR # VSENSKKLNVCASETQESNTHDESIKKNDEEKKDDGSVRCSLKIEVIDDTAMIDISQVGKSCSIDKNFDGKSGRNRKKKNANQMVTVKAKDRKIEEKN # VNGGCKINGGEEKRVYCRKELENLRFVGMEQQRKMWVELYCGLGDTVQKEYDGLVDSNTQKHIRLSRSRRHIGKENTPVISGVLAAKERGKHMKVYTQ # RGMTYMNLQNTLCLPGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 89.5 # CDS exons: 9/10 # E: 9 # CDS introns: 8/9 # E: 8 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 8 # E: 8 (SGN-U333212,SGN-U316460,SGN-U335681,SGN-U316459,SGN-U335683,SGN-U335684,SGN-U335596,...) C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 40738 53120 . - . ID=g5.t4;Parent=g5 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 40738 40740 . - 0 Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 40738 40841 . - 2 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 41293 41874 . - 2 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 46079 46562 . - 0 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 46640 46846 . - 0 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 49654 49721 . - 2 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 49812 49904 . - 2 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52209 52290 . - 0 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52389 52441 . - 2 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 52868 52967 . - 0 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 53109 53120 . - 0 ID=g5.t4.cds;Parent=g5.t4 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 53118 53120 . - 0 Parent=g5.t4 # protein sequence = [MDYSMEQLLSPLVFNGSTVEAITEAKQKKKLFVVLVSGGNMESNQSETSTWLDPRVADSISKYCILLHILEGSTDARN # FSALYPQEAIPCITVIGYNGVQLWQHGMDQLNLMFGGFVSAENLASSLEKAWLSLHVQDTTTTLLTAALASRKDLVSGASSVTAEVGSSSSAQVSPAQ # AITHIQSPLATLSKNSQIVEGEDPGHAAMDIDSSLIDMDSHGSADAFESRIGDFNESTTVITTAEKPLDLVEVDSNKGKDECSMSKENPGLRDQHLDP # SDEAPREIANKAGKDPEINIVEDAAAESDDSSNIFHDVCLNIRLPDGSSLQVKFLVVDTLRMVKHYVDKNQTSSIGYYDLAVPYPRKVFGDEDDFGSH # ASSEFSNTRVSENSKKLNVCASETQESNTHDESIKKNDEEKKDDGSVRCSLKIEVIDDTAMIDISQVGKSCSIDKNFDGKSGRNRKKKNANQMVTVKA # KDRKIEEKNVNGGCKINGGEEKRVYCRKELENLRFVGMEQQRKMWVELYCGLGDTVQKEYDGLVDSNTQKHIRLSRSRRHIGKENTPVISGVLAAKER # GKHMKVYTQRGMTYMNLQNTLCLPGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 89.5 # CDS exons: 9/10 # E: 9 # CDS introns: 8/9 # E: 8 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U335684) # incompatible hint groups: 7 # E: 7 (SGN-U333212,SGN-U316460,SGN-U335681,SGN-U316459,SGN-U335683,SGN-U335596,SGN-U335680) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 55850 56961 1 + . ID=g6 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 55850 56961 . + . ID=g6.t1;Parent=g6 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 55850 55852 . + 0 Parent=g6.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 55850 56240 . + 0 ID=g6.t1.cds;Parent=g6.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 56321 56480 . + 2 ID=g6.t1.cds;Parent=g6.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 56553 56961 . + 1 ID=g6.t1.cds;Parent=g6.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 56959 56961 . + 0 Parent=g6.t1 # protein sequence = [MKMRMIMILFLLVIIGGFVHGDENESFRKQPTLVKTVKGTKMCVKDWECNKLSKFCCNLTITDYLDVDQFELLFTKRN # SPVAHAVGFWDYGSFIRAAALYQPLGFGTTGGKKMQMKEIAAFFGHVGSKTSCGYGVATGGPLAYGLCYNKEMSPSQDYCDEYFKLTYPCTPGARYYG # RGALPIYWNYNYGAIGEALKLNLLDHPEYIEQNATMAFQAAIWRWMNPMKKGQPSAHDAFVGNWKPTKNDTLSKRVPGFGTTMNILYGDGVCGQGDVD # AMNNIVSHYLYYLDLMGVGREEAGPHEVLNCAEQKPFNPTAVAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 3/3 # E: 3 # CDS introns: 2/2 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 4 # E: 4 (SGN-U312838,SGN-U333961,SGN-U333962,SGN-U333963) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 57693 63538 1 - . ID=g7 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 57693 63538 . - . ID=g7.t1;Parent=g7 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 57693 57695 . - 0 Parent=g7.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 57693 57743 . - 0 ID=g7.t1.cds;Parent=g7.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 58444 58575 . - 0 ID=g7.t1.cds;Parent=g7.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 61521 61705 . - 2 ID=g7.t1.cds;Parent=g7.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 62635 63538 . - 0 ID=g7.t1.cds;Parent=g7.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 63536 63538 . - 0 Parent=g7.t1 # protein sequence = [MVIHFIYLLLYSFHVDFQLSQFRSLPLYFVCKKVVVVFCHTNAMNLSLYTISLSPSNSIRFTSPKRCCHYHVISRRVS # PSPYRRRHLRRRRFPFLKKFSPEDTPPSDQNLHFVLTVDNLPTKSFYSIKDLIHLKLREFLHSGRAAIEDLQTLIRIDTDAGRVSFSCTRSTVKFLAT # LLVSTFLLIFTLRAILNLVRRIPLNTGNNNVELVYKRDRSLGGREVLVAKNETPTLDRKKPNVLDRDEGNSNWDLDTPISFSRRRKKKSSVEQLPKWW # PVSTSGSDQVGTENQEEYQRMADRLIRVSSSLLFCSTASQSAFVLIDGEEAQNFVAGLADNVGLESTRAARMVSAAVAARTRSRFLQAWPEMEMVARG # LEKHLKVDQRESLMNSLLQVCGDETRRSVAEALGLMYMKSNIAHQQENKYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 14.3 # CDS exons: 1/4 # E: 1 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U332708,SGN-U327064) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 64528 76861 2 - . ID=g8 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 64528 76861 . - . ID=g8.t1;Parent=g8 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 64528 64530 . - 0 Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 64528 64578 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 64672 64720 . - 1 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 65694 65773 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 65854 65987 . - 2 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 66157 66264 . - 2 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 66862 66931 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 67580 67657 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 67795 67917 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 68054 68113 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 69755 69799 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 70725 70802 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 76101 76157 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 76241 76357 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 76694 76861 . - 0 ID=g8.t1.cds;Parent=g8.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 76859 76861 . - 0 Parent=g8.t1 # protein sequence = [MKNGMAECAVCHSKLVSPSVKTISRAYDRHRSKISSKQRALNVLLVVGDCMLVGLQPVLVFMSKVDGKFKFSPVSVNF # LTEATKVVFAIIMLLIQARHQKVGEKPLLSISTFVQAARNNVLLAVPALLYAINNYLKFIMQLYFNPATVKMLSNLKVLVIAVLLKFIMKRRFSVIQW # EALALLLIGISINQLRSLPEGTTSLALPVTTIAYIYTLIFVTVPSMASVFNEYALKSQYDTSIYLQNLFLYGYGAIFNFLAILGIAVFKGPGSLDIFQ # GHSKATMLLIVNNAAQGILSSFFFKYADTILKKYSSTVATIFTGIASALLFGHTLTVNFLLGISVVFISMHQFFSPLSKVKDDQQNGTVELIDVRENH # SPKDSSFVNMAAGANEEASHRVGPDERQPLLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 96.3 # CDS exons: 14/14 # E: 14 # CDS introns: 12/13 # E: 12 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U327064,SGN-U322247,SGN-U322248) C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 64528 76861 . - . ID=g8.t2;Parent=g8 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 64528 64530 . - 0 Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 64528 64578 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 64672 64720 . - 1 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 65694 65773 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 65854 65987 . - 2 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 66157 66264 . - 2 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 66862 66931 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 67580 67657 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 67795 67917 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 68054 68113 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 76101 76157 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 76241 76357 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 76694 76861 . - 0 ID=g8.t2.cds;Parent=g8.t2 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 76859 76861 . - 0 Parent=g8.t2 # protein sequence = [MKNGMAECAVCHSKLVSPSVKTISRAYDRHRSKISSKQRALNVLLVVGDCMLVGLQPVLVFMSKVDGKFKFSPVSVNF # LTEATKVVFAIIMLLIQARHQKVGEKPLLSISTFVQVLVIAVLLKFIMKRRFSVIQWEALALLLIGISINQLRSLPEGTTSLALPVTTIAYIYTLIFV # TVPSMASVFNEYALKSQYDTSIYLQNLFLYGYGAIFNFLAILGIAVFKGPGSLDIFQGHSKATMLLIVNNAAQGILSSFFFKYADTILKKYSSTVATI # FTGIASALLFGHTLTVNFLLGISVVFISMHQFFSPLSKVKDDQQNGTVELIDVRENHSPKDSSFVNMAAGANEEASHRVGPDERQPLLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 95.7 # CDS exons: 12/12 # E: 12 # CDS introns: 10/11 # E: 10 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U327064,SGN-U322247,SGN-U322248) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 81740 82852 1 - . ID=g9 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 81740 82852 . - . ID=g9.t1;Parent=g9 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 81740 81742 . - 0 Parent=g9.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 81740 82852 . - 0 ID=g9.t1.cds;Parent=g9.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 82850 82852 . - 0 Parent=g9.t1 # protein sequence = [MGVEVTSWVVEERSSSMVEEVISWVVVGKNSSMVEEVISWVVVGKNSSMVVEVMVKVVEETCSNKVEVVMVKVAEETC # SNKVEVVMVKVVEVTCSNKVEVVMVKVVEETCSNKVEVVMVKVEVETCNNKVEVVMVMEVVETCSSKVVVVRDQVVEGTCSSMVVVGKVMVVAETCNS # KVVEEMVMEVVGICSSKVVEEMVRVEEVIYSSKVVEEREKEVVGTCRRMVVVEKVMVVVGTCTRTVVEEREKEVAGTCTRTVVEEREKEVAGTCTRTV # VEEREKEVAGTCTRMVVVEKEKEVVGICTHTVVVERHICKGQQKQYQQEPKWPLRYVANNDDPGRGRQQKASLLAGIMHQPPVPQIWGMYNKTLWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U336084) # incompatible hint groups: 0 ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 84044 85292 1 + . ID=g10 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 84044 85292 . + . ID=g10.t1;Parent=g10 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 84044 84046 . + 0 Parent=g10.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 84044 84050 . + 0 ID=g10.t1.cds;Parent=g10.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 84121 85292 . + 2 ID=g10.t1.cds;Parent=g10.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 85290 85292 . + 0 Parent=g10.t1 # protein sequence = [MQGFDYAKYGADACKAKLHKAPKDSKCNIATDLHWGIKGAKLKVKSKNHYEVVLSAKPFAYAPKTPYQECMKPKPTPT # PYYYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPLPKY # VYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVY # KSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKLPTPRVRPXXXXXXXXXXXXXXXXXXX # XXXXXXXXXXXXXXXRTTCN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 33.3 # CDS exons: 1/2 # E: 1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 2 # E: 2 (SGN-U315189,SGN-U313905) # incompatible hint groups: 0 ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 86990 87553 1 + . ID=g11 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 86990 87553 . + . ID=g11.t1;Parent=g11 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 86990 86992 . + 0 Parent=g11.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 86990 87553 . + 0 ID=g11.t1.cds;Parent=g11.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 87551 87553 . + 0 Parent=g11.t1 # protein sequence = [MEEEETSRVEVESDSSREGVVMVMGVVVICSSMVEEETVMVVVGTCSSMVEEEMAMVVEETCSNREVEVMGMVVVVIC # SSMEVGVMVMVVEETCSSMVVGEMGLVVVETCSSMVEEETCSSREVGVMVMVVEETCSSREVGVMVMVVEETXXXXXXXXXXXXXXXXXXXXXXXXXX # XXXXXXXXGPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 88225 94072 1 - . ID=g12 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 88225 94072 . - . ID=g12.t1;Parent=g12 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 88225 88227 . - 0 Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 88225 88248 . - 0 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 88979 89054 . - 1 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 89153 89250 . - 0 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 91867 91941 . - 0 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 92010 92101 . - 2 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 92232 92306 . - 2 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 93643 93801 . - 2 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 93883 94072 . - 0 ID=g12.t1.cds;Parent=g12.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 94070 94072 . - 0 Parent=g12.t1 # protein sequence = [MPSQMNLQYSQNQTNNVSMSILSTPVSTALISSSQPAKDKFETKSTVWADTLSRGLVNLNISGSKTNPLADIGVDFDA # INRKEKRMEKPSITTPVTSTVTMGKAMGSGSGIGRAGAGRYCNSDFRKRHTSSEMTYELDEQKKVGLGLIGFGIFFTFLAIMLFFDRGLLALANILLL # AGVALLLGLRSTLQLFKVNYKGTISFMLGLFLIFVRWPVVGIIVEIYGCIILFGCFWPSIKVFLFQIPVFGWILQYPALLLDRFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 73.3 # CDS exons: 6/8 # E: 6 # CDS introns: 5/7 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U324147) ### ### C09SLm0058A04.1 AUGUSTUS_tom_ugs gene 94779 95067 1 + . ID=g13 C09SLm0058A04.1 AUGUSTUS_tom_ugs transcript 94779 95067 . + . ID=g13.t1;Parent=g13 C09SLm0058A04.1 AUGUSTUS_tom_ugs start_codon 94779 94781 . + 0 Parent=g13.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 94779 94854 . + 0 ID=g13.t1.cds;Parent=g13.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs CDS 94925 95067 . + 2 ID=g13.t1.cds;Parent=g13.t1 C09SLm0058A04.1 AUGUSTUS_tom_ugs stop_codon 95065 95067 . + 0 Parent=g13.t1 # protein sequence = [MSDVGTALKGPSPKGSSNICKKSAFLVLEALTSDVVVAVDARTNESEENGSDKQPSGSTSVPTEVVGIGLFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C09SLm0058A04-I962s/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C09SLm0058A04-I962s/AUGUSTUS_tom_ugs/seq_with_defline_removed