##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C12HBa0011D12-sQZmv/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C12HBa0011D12-sQZmv/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 105818, name = C12HBa0011D12.1) ----- # # Delete group HintGroup SGN-U324133, 333-3810, priority= 4 7 features # Delete group HintGroup SGN-U337962, 333-3816, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U318164, 5751-9288, priority= 4 9 features # Delete group HintGroup SGN-U336412, 5783-7360, priority= 4 5 features # Set orientation to reverse for hint group HintGroup SGN-U318162, 8360-9894, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U337416, 24020-26699, priority= 4 5 features # Delete group HintGroup SGN-U321611, 24033-29579, priority= 4 14 features # Set orientation to forward for hint group HintGroup SGN-U337417, 24209-27094, priority= 4 5 features # Set orientation to forward for hint group HintGroup SGN-U327052, 30200-33224, priority= 4 11 features # Set orientation to reverse for hint group HintGroup SGN-U337212, 35908-36844, priority= 4 7 features # Set orientation to reverse for hint group HintGroup SGN-U320764, 35964-44515, priority= 4 33 features # Set orientation to forward for hint group HintGroup SGN-U323380, 49564-54926, priority= 4 21 features # Set orientation to forward for hint group HintGroup SGN-U333076, 59045-60367, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U327991, 60383-61538, priority= 4 3 features # Delete group HintGroup SGN-U316887, 74278-78131, priority= 4 9 features # Set orientation to forward for hint group HintGroup SGN-U325751, 78159-84430, priority= 4 15 features # Set orientation to reverse for hint group HintGroup SGN-U316934, 84408-90364, priority= 4 17 features # Set orientation to forward for hint group HintGroup SGN-U317961, 94238-97594, priority= 4 3 features # Forced unstranded hint group to the only possible strand for 13 groups. # Deleted 5 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 6089 9529 1 - . ID=g1 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 6089 9529 . - . ID=g1.t1;Parent=g1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 6089 6091 . - 0 Parent=g1.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 6089 6380 . - 1 ID=g1.t1.cds;Parent=g1.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 7222 7490 . - 0 ID=g1.t1.cds;Parent=g1.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 7690 7953 . - 0 ID=g1.t1.cds;Parent=g1.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 8316 8443 . - 2 ID=g1.t1.cds;Parent=g1.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 9235 9529 . - 0 ID=g1.t1.cds;Parent=g1.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 9527 9529 . - 0 Parent=g1.t1 # protein sequence = [MAKNGVIVEMSSLNNNNNENCGVRVSWDSDLGFYADVGGEQLWIDVLHNTLEYGLAPVSWTDYLYLTVGGTLSNAGIS # GQTFRYGPQISNVHEMDVITGKGELMTCSKDMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYDDFSKFTKDQEHLISIHNNGLDYVEGS # LMMEQSSLNNWRSSFYSPSNQTKIASLLSKNKIMYCLEIVKYYDDQNANTIDKELKKLVKGLKYVGGFMFKKDVSFVEFLNRVRSGELELQSKGMWDV # PHPWLNLFVPKSSIMHFNAAVFVDIILRQNKTNGPILVYPTSRKRWDDRMSAIIPEEETFYCVGLLHSSSGYNECKILDNQNEEILNYCDKVGLNIKQ # YLPHYKTKEDWIKHFGKKWNIFQQRKDLFDPKMILSPGQRIFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 5/5 # E: 5 # CDS introns: 4/4 # E: 4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 7 # E: 7 (SGN-U318164,SGN-U318162,SGN-U318985,SGN-U331571,SGN-U329100,SGN-U338769,SGN-U318163) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 24120 28583 1 + . ID=g2 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 24120 28583 . + . ID=g2.t1;Parent=g2 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 24120 24122 . + 0 Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 24120 24267 . + 0 ID=g2.t1.cds;Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 24404 24466 . + 2 ID=g2.t1.cds;Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 26641 26702 . + 2 ID=g2.t1.cds;Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 28157 28238 . + 0 ID=g2.t1.cds;Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 28334 28401 . + 2 ID=g2.t1.cds;Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 28479 28583 . + 0 ID=g2.t1.cds;Parent=g2.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 28581 28583 . + 0 Parent=g2.t1 # protein sequence = [MAEKLQIVEVLYCGVCGLPAEYCEFGSEFEKCKPWLIQNAPDLYPDLVKDSNLKEADKVTDQLQSTSISEGSSTSKKE # EVKRLPGGKIKKKDKQEIIIEKVTRNRRKSITTIKGLEIFGVKLTDASKKLGKKFATGASVVKGPTEKEQIDVQGDISYDIVDFITETWPDVCCLIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 45.5 # CDS exons: 3/6 # E: 3 # CDS introns: 2/5 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 5 # E: 5 (SGN-U337416,SGN-U337417,SGN-U339281,SGN-U328645,SGN-U332269) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 31337 33804 1 + . ID=g3 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 31337 33804 . + . ID=g3.t1;Parent=g3 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 31337 31339 . + 0 Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 31337 31692 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 32287 32467 . + 1 ID=g3.t1.cds;Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 32567 32655 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 32748 32835 . + 1 ID=g3.t1.cds;Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 32941 33273 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 33370 33804 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 33802 33804 . + 0 Parent=g3.t1 # protein sequence = [MTVRSNSFKGTHLETIIQSNNEVDKMTRKNSINLRNCDPKKLMLETTLSFKNLVQDLDISEWNEKKTRATVSLPEPSI # LFSPRPVSELDAAAVKLQKVYKSYRTRRNLADCAVVVEELWWKALDFAALKRSSVSFFNVEKPETAVSRWARARTRAAKVGKGLSKDEKAQKLALQHW # LEAIDPRHRYGHNLHFYYDIWFESESSQPFFYWLDVGDGKEINLEKCPRFNLQHQCIKYLGPKERESYEVVIQDGKLVYKQNGVFVETVEGSKWIFVL # STTRTLYVGKKKKGVFQHSSFLSGGATTAAGRLVAHGGVLKAIWPYSGHYHPTEENFREFISFLEEHSVDLTNVKRCSVDDDDHSFRVNNEGSNHQSL # ITKESPKRSTEEKTEEKREVNTTDDEREDKKQEDTSFSFAKRLSRKWSTGNGPRIGCVREYPTELQFRALEQVNLSPRVANGGFNMYGPIPSPRPSPK # IRLSPRIAYMGLPSPRTPISAAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 81.8 # CDS exons: 5/6 # E: 5 # CDS introns: 4/5 # E: 4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U327052,SGN-U325864) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 36189 44264 1 - . ID=g4 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 36189 44264 . - . ID=g4.t1;Parent=g4 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 36189 36191 . - 0 Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 36189 36293 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 36387 36440 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 36611 36673 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 36806 36853 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 37830 37892 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 38061 38081 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 38204 38285 . - 1 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 38982 39118 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 39202 39270 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 39997 40083 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 40265 40388 . - 1 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 41161 41228 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 41440 41515 . - 1 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 41598 41671 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 42431 42511 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 43890 44264 . - 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 44262 44264 . - 0 Parent=g4.t1 # protein sequence = [MTINPESITSSSDGNNNLRRRRSGGGGGDRSVNDVTELDSSSVDASSSSDDVTSDVMDGSGNGGLDRVSEAVSTTIGK # ISDGDGIQEEQRKANETTPLKYVYRASAPAHRRNKESPLSSAAIFKQSHAGLLNLCIVVLIAVNSRLIIENLMKYGLLIGSGFWSSSTSVRDWPLLMC # CLSLPIFPLAAFLVEKMAQKKYMTEHVVVTLHIIITTASILYPVLVILRCDSAFLSGVTLMMFACIVWMKLVSYAHTNYDMRQLAKSVNEGENSEINY # SYNVSFESLAYFMVAPTLCYQGWLARQLIKLVIFTGLMGFIIEQYINPIVRSSRHPFEGNLLYAIERVLKLSVPILYVWLCMFYSLFHLWLNILAEVL # RFGDREFYKDWWNAKTIDEYWRLWNMPVHKWMVRHIYFPCLRNGIPKGVAMVISFFISAVFHELCIAVPCRLFKFWAFLGIMFQIPLVILTNFLQNKF # KNSNVGNMTFWCFFCIVGQPMCVLLYYHDVMNRNGSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 16/16 # E: 16 # CDS introns: 15/15 # E: 15 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U337212,SGN-U320764,SGN-U346783) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 49847 54718 1 + . ID=g5 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 49847 54718 . + . ID=g5.t1;Parent=g5 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 49847 49849 . + 0 Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 49847 50050 . + 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 50957 51128 . + 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 51845 51980 . + 2 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 52093 52203 . + 1 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 52283 52385 . + 1 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 52702 52845 . + 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 52942 53049 . + 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 53136 53232 . + 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 53457 53582 . + 2 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 53796 53928 . + 2 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 54553 54718 . + 1 ID=g5.t1.cds;Parent=g5.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 54716 54718 . + 0 Parent=g5.t1 # protein sequence = [MPRKKQSFWRMSSMKVKCNSSSGSDSCVVDKEDFADEEDYIKAGGSQLVFVQMQQKKDMDQQSKLSDELRQISAGQTV # LDLVVIGCGPAGLALAAESAKLGLNVGLVGPDLPFTNNYGVWEDEFKDLGLQACIEHVWRDTIVYLDDDEPILIGRAYGRVSRHFLHEELLKRCVEAG # VLYLNSKVDRIVEATNGQSLVECEGDVVIPCRFVTVASGAASGKFLQYELGGPRVSVQTAYGVEVEVDNNPFDPSLMVFMDYRDYVRHDAQSLEAKYP # TFLYAMPMSPTRVFFEETCLASKDAMPFDLLKKKLMLRLNTLGVRIKEIYEEEWSYIPVGGSLPNTEQKTLAFGAAASMVHPATGYSVVRSLSEAPKC # ASVLANILRQHYSKNMLTSSSIPSISTQAWNTLWPQERKRQRSFFLFGLALILQLDIEGIRSFFRAFFRVPKWMWQGFLGSSLSSADLMLFAFYMFII # APNDMRKGLIRHLLSDPTGATLIRTYLTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 11/11 # E: 11 # CDS introns: 10/10 # E: 10 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U323380,SGN-U345383) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 55953 60898 1 + . ID=g6 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 55953 60898 . + . ID=g6.t1;Parent=g6 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 55953 55955 . + 0 Parent=g6.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 55953 56063 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 58453 58554 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 58811 59239 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 59842 60588 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 60695 60898 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 60896 60898 . + 0 Parent=g6.t1 # protein sequence = [MKVKVDGDAGASPAPAPVNVTVAVAVKSVEGNGSQRALDIQDEVERLRLELQDTLAIYNQACEDLTHARNKVQLFSSQ # YLEESGKVNAAKKREENLRKIAAEEKGKHMEAEKEVEIARKLLSKEVYERQIAELKALQQSLEKKRIVDALLSSDGRYRRFTRREIEVATDYFSESKM # IGEGAYGKVYKGDLDHTPVAIKVLHSDASEKKEEFLKEVEVLSQLHHPHIVLLLGACPENGCLAYEYMENGNLEDYILERNSKPLPWFSRFRILFEVA # CALAFLHNSKPEPVIHRDLKPGNILLDKNFVSKIGDVGLAKIISDVVPENVTEYRNSVLAGTLGYMDPEYQRTGTLRPKSDLYAFGIIILQLLTARRP # NGLIMKFENAINCNSLVDILDKSVPDWPLIEVEELGRMALKCCMLRCRERPDLDTEVLPLLKRLAGYADMHSNEEKNLIHAPIQYLCPILQEVMEDPQ # IAADGYTYEHRAIKLWFDRYSVSPMTKQRLQHKLVTPNHTLRLAIQEWRSTFNNIQIEKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 55.6 # CDS exons: 3/5 # E: 3 # CDS introns: 2/4 # E: 2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 2 # E: 2 (SGN-U333076,SGN-U345355) # incompatible hint groups: 2 # E: 2 (SGN-U327076,SGN-U327991) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 65555 67009 1 + . ID=g7 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 65555 67009 . + . ID=g7.t1;Parent=g7 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 65555 65557 . + 0 Parent=g7.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 65555 67009 . + 0 ID=g7.t1.cds;Parent=g7.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 67007 67009 . + 0 Parent=g7.t1 # protein sequence = [MEITSFSSSFPSQEDFNSLNFFQELDFLSPSSDHHHHQSMSKKIKINDFDHNPVEEILNKFLGVENETHPESKSVENH # TLFDYKNQKFDFDHGVVSGTKRVRENANENEDGLVEVISGSGSGSGYSQQPLQQRRLWVKNRSNAWWEQCNRPDFPEEEFKKAFHMGKATFDFICSEI # ESVVTKKDTMLRMAIPVRQRVAVCIWRLATGEPLREVSRRFGLGISTCHKLVLEVCTAIRGVLMAKFIQWPDELKMEEIKHEFEILSGIENVGGSMYT # THVPIIAPKESVASYFNKRHTERNQKTSYSVTVQGVVDPKGIFTDVCIGWPGSMTDDQVLEKSILYERANRGNLNGTYIVGSSGFPLTDWILVPFTHQ # NVTWTQHAFNEKVNDVQRVAKEAFMRLKARWSCLKKRTEVKLQDLPVVLGACCTLHNICEIRGEELRQELRFDLVDDEMIPEVVVRSMNAMKVRDQIA # HKLLHHNHSGTSFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U316186) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 86087 89973 1 - . ID=g8 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 86087 89973 . - . ID=g8.t1;Parent=g8 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 86087 86089 . - 0 Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 86087 86185 . - 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 86275 86320 . - 1 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 86431 86654 . - 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 87068 87250 . - 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 87333 87557 . - 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 88338 88472 . - 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 89645 89729 . - 1 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 89897 89973 . - 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 89971 89973 . - 0 Parent=g8.t1 # protein sequence = [MKKGSFAPNLKLSLPPPDEVALSKFLTESGTFKDGDLLVNRDGVRIVSQSEVAAPSVIQPSDNQLCLADFEAVKVIGK # GNGGIVRLVQHKWTGQFFALKVIQMNIDESMRKHIAQELRINQSSQCPYVVICYQSFFDNGAISLILEYMDGGSLADFLKKVKTIPERFLAVICKQVL # KGLWYLHHEKHIIHRDLKPSNLLINHRGDVKITDFGVSAVLASTSGLANTFVGTYNYMSPERISGGAYDYKSDIWSLGLVLLECATGHFPYKPPEGDE # GWVNVYELMETIVDQPEPCAPPDQFSPQFCSFISACVQKHQKDRLSANDLMSHPFITMYDDQDIDLGSYFTSAGPPLATLTEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 8/8 # E: 8 # CDS introns: 7/7 # E: 7 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U316934) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 94252 97544 1 + . ID=g9 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 94252 97544 . + . ID=g9.t1;Parent=g9 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 94252 94254 . + 0 Parent=g9.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 94252 94590 . + 0 ID=g9.t1.cds;Parent=g9.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 96912 97544 . + 0 ID=g9.t1.cds;Parent=g9.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 97542 97544 . + 0 Parent=g9.t1 # protein sequence = [MKLASLDSVTNAHDDSIWSAAWVRSTEEYPALLLTGGLDETVRLWDPSNFACVQTFTGHCLGVVSVATHPTRRIAASA # SIDSFIRVFEVDTNNTIATLEAPPSEVWQLQFSPSGSNLAAAGGGSSSVKVWDTNRWELVTTMSIPRQGAPQPSDKSTNKKFVLSVAWSPDGSLLACG # SVDGTISVFDVARAKFLHFLDGHTMPVRSLVFSPSLHDSRILFSASDDGHVHMYDAEGKTLLTSLSGHASWVLSVDISPDGAAIATGSSDKTVRLWDL # KMRAATQTLTNHTDQVWAVAFGPTSRTDVRSCMLASVSDDKSLSFYQYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 1 # E: 1 (SGN-U317961) ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 100468 102336 1 + . ID=g10 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 100468 102336 . + . ID=g10.t1;Parent=g10 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 100468 100470 . + 0 Parent=g10.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 100468 101016 . + 0 ID=g10.t1.cds;Parent=g10.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 101423 101695 . + 0 ID=g10.t1.cds;Parent=g10.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 101789 101920 . + 0 ID=g10.t1.cds;Parent=g10.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 102157 102336 . + 0 ID=g10.t1.cds;Parent=g10.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 102334 102336 . + 0 Parent=g10.t1 # protein sequence = [MEGSEGSDPNTNVVERMDSSCYVSFFKDQESFGVVAAVVVAIIVPLFLSVVLMRKKKAKQRGVSVKAGGEAGLTMRNA # KSAKLIEVPWEGATTMAALFERSCRKHSSKRCLGTRKLVSRDFVTAKDGRKFEKLHLSEYHWESYGQTFDRACNFASGLVNLGHDVETRAAIFSETRA # EWIIAFQTQASTLICDAKQLKKLAAIGSNLKTISNVIYFEDDETSIDSSTSTDIDSWRVTSFSEVEKLGKSNPIQPILPIKKDIAVIMYTSGSTGMPK # GVMITHGNIVATAAAVTTVIPKLGSNDVYLGYLPLAHVFELAAETVMLTAGASIGYGSALTLTDTSNKIMKGTKGDASALKPTLMAAVPAILDRVKDG # VIKKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 14.3 # CDS exons: 1/4 # E: 1 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U336917) # incompatible hint groups: 0 ### ### C12HBa0011D12.1 AUGUSTUS_tom_ugs gene 103131 103794 1 + . ID=g11 C12HBa0011D12.1 AUGUSTUS_tom_ugs transcript 103131 103794 . + . ID=g11.t1;Parent=g11 C12HBa0011D12.1 AUGUSTUS_tom_ugs start_codon 103131 103133 . + 0 Parent=g11.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 103131 103217 . + 0 ID=g11.t1.cds;Parent=g11.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs CDS 103540 103794 . + 0 ID=g11.t1.cds;Parent=g11.t1 C12HBa0011D12.1 AUGUSTUS_tom_ugs stop_codon 103792 103794 . + 0 Parent=g11.t1 # protein sequence = [MPRGEVVVGGNSVTAGYFNNGDKTNEEYKVEAALSSSNYVDNIMAYADPFHSYCVALVVPSQKVLEKWAQENGIEHRA # FSDLCNKVEAVNEVQQSLSKVRLLFIRIIINHDPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C12HBa0011D12-sQZmv/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C12HBa0011D12-sQZmv/AUGUSTUS_tom_ugs/seq_with_defline_removed