##gff-version 3 # This output was generated with AUGUSTUS (version 2.0.2). # AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de). # Please cite: Mario Stanke and Stephan Waack (2003) "Gene prediction with a hidden Markov model and # a new intron submodel", Bioinformatics, Vol. 19 Suppl. 2, ii215-ii225 # reading in the file /tmp/bac-submission-temp-C12HBa0165F06-ZSJOl/AUGUSTUS_tom_ugs/hints.gff ... # Sources of extrinsic information: M E # Have extrinsic information about 1 sequences (in the specified range). # Initialising the parameters ... # human version. Use default transition matrix. # Looks like /tmp/bac-submission-temp-C12HBa0165F06-ZSJOl/AUGUSTUS_tom_ugs/seq_with_defline_removed is in fasta format. # We have hints for 1 sequence and for 1 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 120484, name = C12HBa0165F06.1) ----- # # Set orientation to reverse for hint group HintGroup SGN-U341412, 1827-2842, priority= 4 3 features # Delete group HintGroup SGN-U335704, 9441-74737, priority= 4 5 features # Delete group HintGroup SGN-U316749, 18235-91514, priority= 4 3 features # Set orientation to forward for hint group HintGroup SGN-U325887, 19101-21262, priority= 4 9 features # Set orientation to forward for hint group HintGroup SGN-U341066, 21361-23031, priority= 4 5 features # Delete group HintGroup SGN-U329094, 24238-24667, priority= 4 2 features # Delete group HintGroup SGN-U337828, 28939-79912, priority= 4 5 features # Delete group HintGroup SGN-U318086, 28940-79763, priority= 4 7 features # Delete group HintGroup SGN-U321738, 28957-91797, priority= 4 4 features # Delete group HintGroup SGN-U312550, 28960-92044, priority= 4 10 features # Set orientation to forward for hint group HintGroup SGN-U346649, 29167-30393, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U318876, 33528-38101, priority= 4 11 features # Set orientation to forward for hint group HintGroup SGN-U344695, 39544-40781, priority= 4 7 features # Delete group HintGroup SGN-U319981, 74731-117859, priority= 4 3 features # Set orientation to reverse for hint group HintGroup SGN-U325341, 77175-79248, priority= 4 11 features # Delete group HintGroup SGN-U322533, 79569-79731, priority= 4 3 features # Delete group HintGroup SGN-U321239, 79569-79732, priority= 4 3 features # Delete group HintGroup SGN-U335360, 79569-79734, priority= 4 3 features # Delete group HintGroup SGN-U338804, 79570-91611, priority= 4 4 features # Delete group HintGroup SGN-U343963, 79570-91930, priority= 4 4 features # Delete group HintGroup SGN-U321517, 79570-91529, priority= 4 6 features # Delete group HintGroup SGN-U312769, 79570-91529, priority= 4 6 features # Delete group HintGroup SGN-U325723, 79570-79736, priority= 4 3 features # Delete group HintGroup SGN-U314595, 79571-79742, priority= 4 3 features # Delete group HintGroup SGN-U327091, 79571-79732, priority= 4 3 features # Delete group HintGroup SGN-U328919, 79571-79733, priority= 4 3 features # Delete group HintGroup SGN-U339989, 79571-79734, priority= 4 3 features # Delete group HintGroup SGN-U341162, 79571-79734, priority= 4 3 features # Delete group HintGroup SGN-U313670, 79571-79735, priority= 4 3 features # Delete group HintGroup SGN-U320485, 79571-79735, priority= 4 3 features # Delete group HintGroup SGN-U343523, 79571-91529, priority= 4 4 features # Delete group HintGroup SGN-U343876, 79571-91797, priority= 4 4 features # Delete group HintGroup SGN-U331462, 79572-79738, priority= 4 3 features # Delete group HintGroup SGN-U313782, 79572-79738, priority= 4 5 features # Delete group HintGroup SGN-U344965, 79572-79738, priority= 4 5 features # Delete group HintGroup SGN-U341145, 79572-79733, priority= 4 3 features # Delete group HintGroup SGN-U314433, 79572-79735, priority= 4 3 features # Delete group HintGroup SGN-U330728, 79572-79737, priority= 4 3 features # Delete group HintGroup SGN-U315322, 79572-79739, priority= 4 3 features # Delete group HintGroup SGN-U341491, 79572-79926, priority= 4 5 features # Delete group HintGroup SGN-U338859, 79573-91511, priority= 4 4 features # Delete group HintGroup SGN-U326537, 79573-79732, priority= 4 3 features # Delete group HintGroup SGN-U328552, 79573-79737, priority= 4 3 features # Delete group HintGroup SGN-U325395, 79573-79753, priority= 4 3 features # Delete group HintGroup SGN-U333790, 79573-79757, priority= 4 3 features # Delete group HintGroup SGN-U345148, 79573-91797, priority= 4 4 features # Delete group HintGroup SGN-U339835, 79573-91511, priority= 4 6 features # Delete group HintGroup SGN-U334113, 79573-91529, priority= 4 3 features # Delete group HintGroup SGN-U312348, 79573-79914, priority= 4 7 features # Delete group HintGroup SGN-U313370, 79573-79739, priority= 4 3 features # Delete group HintGroup SGN-U334771, 79573-91528, priority= 4 5 features # Delete group HintGroup SGN-U322600, 79573-79951, priority= 4 5 features # Delete group HintGroup SGN-U334988, 79573-91549, priority= 4 10 features # Delete group HintGroup SGN-U314572, 79573-91952, priority= 4 6 features # Delete group HintGroup SGN-U334457, 79573-91800, priority= 4 4 features # Delete group HintGroup SGN-U334449, 79573-79737, priority= 4 3 features # Delete group HintGroup SGN-U320354, 79573-79716, priority= 4 3 features # Delete group HintGroup SGN-U341371, 79574-79732, priority= 4 3 features # Delete group HintGroup SGN-U316592, 79575-79731, priority= 4 3 features # Delete group HintGroup SGN-U334274, 79575-91508, priority= 4 5 features # Delete group HintGroup SGN-U336354, 79578-91529, priority= 4 3 features # Delete group HintGroup SGN-U330871, 79580-91796, priority= 4 10 features # Delete group HintGroup SGN-U343571, 79731-79912, priority= 4 3 features # Delete group HintGroup SGN-U324118, 79731-91628, priority= 4 5 features # Delete group HintGroup SGN-U336859, 79732-91941, priority= 4 6 features # Delete group HintGroup SGN-U313977, 79735-91884, priority= 4 4 features # Delete group HintGroup SGN-U332637, 79738-79926, priority= 4 3 features # Delete group HintGroup SGN-U312998, 79739-91955, priority= 4 9 features # Delete group HintGroup SGN-U320492, 79739-91511, priority= 4 3 features # Delete group HintGroup SGN-U312856, 79740-91505, priority= 4 3 features # Delete group HintGroup SGN-U329542, 79740-91511, priority= 4 3 features # Delete group HintGroup SGN-U337959, 79740-91874, priority= 4 7 features # Delete group HintGroup SGN-U314643, 79740-79926, priority= 4 3 features # Delete group HintGroup SGN-U339094, 79740-91527, priority= 4 3 features # Delete group HintGroup SGN-U338995, 79740-91949, priority= 4 5 features # Delete group HintGroup SGN-U338951, 79741-91512, priority= 4 4 features # Delete group HintGroup SGN-U322124, 91293-91813, priority= 4 3 features # Delete group HintGroup SGN-U344216, 91409-91902, priority= 4 5 features # Delete group HintGroup SGN-U333472, 91500-91851, priority= 4 3 features # Delete group HintGroup SGN-U315914, 91503-91874, priority= 4 4 features # Delete group HintGroup SGN-U316948, 91504-91852, priority= 4 3 features # Delete group HintGroup SGN-U314677, 91504-91877, priority= 4 4 features # Delete group HintGroup SGN-U316539, 91504-91876, priority= 4 4 features # Delete group HintGroup SGN-U324320, 91504-91882, priority= 4 4 features # Delete group HintGroup SGN-U333985, 91504-91880, priority= 4 4 features # Delete group HintGroup SGN-U345582, 91504-91879, priority= 4 4 features # Delete group HintGroup SGN-U339173, 91504-91877, priority= 4 4 features # Delete group HintGroup SGN-U345213, 91504-91881, priority= 4 4 features # Delete group HintGroup SGN-U322051, 91505-91851, priority= 4 2 features # Delete group HintGroup SGN-U314327, 91505-91873, priority= 4 4 features # Delete group HintGroup SGN-U312516, 91505-91873, priority= 4 4 features # Delete group HintGroup SGN-U318407, 91506-91852, priority= 4 3 features # Delete group HintGroup SGN-U327900, 91506-91852, priority= 4 3 features # Delete group HintGroup SGN-U331857, 91506-91799, priority= 4 3 features # Delete group HintGroup SGN-U317066, 91506-91883, priority= 4 5 features # Delete group HintGroup SGN-U325219, 91507-91852, priority= 4 3 features # Delete group HintGroup SGN-U343529, 91507-91854, priority= 4 5 features # Delete group HintGroup SGN-U313698, 91507-91625, priority= 4 3 features # Delete group HintGroup SGN-U320945, 91507-91882, priority= 4 4 features # Delete group HintGroup SGN-U313558, 91508-91854, priority= 4 3 features # Delete group HintGroup SGN-U324177, 91508-91852, priority= 4 3 features # Delete group HintGroup SGN-U329984, 91508-91852, priority= 4 3 features # Delete group HintGroup SGN-U324383, 91508-91905, priority= 4 6 features # Delete group HintGroup SGN-U338015, 91508-91614, priority= 4 3 features # Delete group HintGroup SGN-U338613, 91508-91625, priority= 4 3 features # Delete group HintGroup SGN-U333060, 91508-91848, priority= 4 5 features # Delete group HintGroup SGN-U312497, 91508-91853, priority= 4 3 features # Delete group HintGroup SGN-U312577, 91508-91883, priority= 4 3 features # Delete group HintGroup SGN-U315207, 91508-91869, priority= 4 8 features # Delete group HintGroup SGN-U324398, 91509-91884, priority= 4 4 features # Delete group HintGroup SGN-U314403, 91509-91616, priority= 4 3 features # Delete group HintGroup SGN-U334961, 91509-91614, priority= 4 2 features # Delete group HintGroup SGN-U313166, 91509-91572, priority= 4 2 features # Delete group HintGroup SGN-U326266, 91509-91890, priority= 4 3 features # Delete group HintGroup SGN-U314384, 91509-91884, priority= 4 3 features # Delete group HintGroup SGN-U339014, 91509-91950, priority= 4 4 features # Delete group HintGroup SGN-U338898, 91509-91612, priority= 4 3 features # Delete group HintGroup SGN-U338996, 91509-91611, priority= 4 3 features # Delete group HintGroup SGN-U338519, 91509-91633, priority= 4 3 features # Delete group HintGroup SGN-U339940, 91554-91950, priority= 4 6 features # Delete group HintGroup SGN-U314948, 91560-91884, priority= 4 3 features # Delete group HintGroup SGN-U343731, 91560-91797, priority= 4 2 features # Delete group HintGroup SGN-U316523, 91639-91799, priority= 4 2 features # Delete group HintGroup SGN-U345986, 91639-91801, priority= 4 2 features # Delete group HintGroup SGN-U332772, 91785-92048, priority= 4 3 features # Delete group HintGroup SGN-U330285, 91785-91909, priority= 4 3 features # Delete group HintGroup SGN-U344185, 91785-91899, priority= 4 3 features # Delete group HintGroup SGN-U314936, 91785-92044, priority= 4 3 features # Delete group HintGroup SGN-U320414, 91785-91956, priority= 4 4 features # Delete group HintGroup SGN-U324883, 91785-91880, priority= 4 3 features # Delete group HintGroup SGN-U313688, 91785-92044, priority= 4 3 features # Delete group HintGroup SGN-U322544, 91785-91906, priority= 4 3 features # Delete group HintGroup SGN-U313428, 91785-92049, priority= 4 3 features # Delete group HintGroup SGN-U317759, 91785-92048, priority= 4 3 features # Delete group HintGroup SGN-U335708, 91785-91904, priority= 4 3 features # Delete group HintGroup SGN-U336194, 91785-91904, priority= 4 3 features # Delete group HintGroup SGN-U333730, 91785-92047, priority= 4 3 features # Delete group HintGroup SGN-U317455, 91785-92048, priority= 4 3 features # Delete group HintGroup SGN-U313406, 91785-92049, priority= 4 3 features # Delete group HintGroup SGN-U339007, 91785-91871, priority= 4 3 features # Delete group HintGroup SGN-U314558, 91785-91913, priority= 4 2 features # Delete group HintGroup SGN-U315151, 91785-91907, priority= 4 3 features # Delete group HintGroup SGN-U313766, 91785-91909, priority= 4 3 features # Delete group HintGroup SGN-U340006, 91791-91877, priority= 4 3 features # Delete group HintGroup SGN-U332785, 91797-91874, priority= 4 3 features # Delete group HintGroup SGN-U326435, 91844-91941, priority= 4 3 features # Forced unstranded hint group to the only possible strand for 7 groups. # Deleted 139 groups because some hint was not satisfiable. # Constraints/Hints: # Predicted genes for sequence number 1 on both strands ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 75 2829 2 - . ID=g1 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 75 1967 . - . ID=g1.t1;Parent=g1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 75 77 . - 0 Parent=g1.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 75 1967 . - 0 ID=g1.t1.cds;Parent=g1.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 1965 1967 . - 0 Parent=g1.t1 # protein sequence = [MTLWTSYLLADWIAIVSLGIIAQNTLDKCKQTSDDDNFKDELMSFWAPFMLLHLGGPDTITAYSLEDNELWLRHLVGL # IIQSGLTFYILLVSLPGSSWLPFLSLFIFVSGVIKFSERTCALRSAKIENLRDSMLTSPDPGPNYAKFMEEYTLKKAEGFYVIADEVKEISLPIDHSY # PTRKDKLLLISEAFDQFQTFKRLFVDLILSFQDRDNSQFYFKQLTPKDAFDVIETELGFAYDTFYTKAPVIYTPLGFILRVITFSCTFFTLISFSLCK # ERSKYHILDLILTYLLLVVAFLLEICALIVLLYSDWTKNWLSKGKHDRKFCQSFLLKKLCLRRSTNMRWSNGTLQYNLLSYCVEFKPPRCYWFQKLFR # INELLEKHKYKKDELVTPGLKKLIFDHFKKFAGESNNKHDHPVLCTSRGTEALKGNGCSSLVWSTELEFDQSFLIWHIATDLCYYTDDSSGTRSIESK # QSKQLSDYMLYLLVVCPFMLPIGLGMIRFRDTCAEAKEFFTERKVGKDLTIASRKLLTVNTEVGPAKVKGDRSKSVLFDACILAKSLKAKGNQRKWEI # ISEVWVEMLAYAATHCRGNHHAQQLRKGGELLTHVWLLMAHLGITEQFQINRGHARAKLIVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 1/1 # E: 1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U324291,SGN-U337995,SGN-U341412) C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 75 2829 . - . ID=g1.t2;Parent=g1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 75 77 . - 0 Parent=g1.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 75 2149 . - 2 ID=g1.t2.cds;Parent=g1.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 2817 2829 . - 0 ID=g1.t2.cds;Parent=g1.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 2827 2829 . - 0 Parent=g1.t2 # protein sequence = [MLLLAASAIFVNAERRRLINLIPDSVRKAWKDWEIEVLILGSLILQIMLILFGKRRQCVANLWIRMTLWTSYLLADWI # AIVSLGIIAQNTLDKCKQTSDDDNFKDELMSFWAPFMLLHLGGPDTITAYSLEDNELWLRHLVGLIIQSGLTFYILLVSLPGSSWLPFLSLFIFVSGV # IKFSERTCALRSAKIENLRDSMLTSPDPGPNYAKFMEEYTLKKAEGFYVIADEVKEISLPIDHSYPTRKDKLLLISEAFDQFQTFKRLFVDLILSFQD # RDNSQFYFKQLTPKDAFDVIETELGFAYDTFYTKAPVIYTPLGFILRVITFSCTFFTLISFSLCKERSKYHILDLILTYLLLVVAFLLEICALIVLLY # SDWTKNWLSKGKHDRKFCQSFLLKKLCLRRSTNMRWSNGTLQYNLLSYCVEFKPPRCYWFQKLFRINELLEKHKYKKDELVTPGLKKLIFDHFKKFAG # ESNNKHDHPVLCTSRGTEALKGNGCSSLVWSTELEFDQSFLIWHIATDLCYYTDDSSGTRSIESKQSKQLSDYMLYLLVVCPFMLPIGLGMIRFRDTC # AEAKEFFTERKVGKDLTIASRKLLTVNTEVGPAKVKGDRSKSVLFDACILAKSLKAKGNQRKWEIISEVWVEMLAYAATHCRGNHHAQQLRKGGELLT # HVWLLMAHLGITEQFQINRGHARAKLIVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 2/2 # E: 2 # CDS introns: 1/1 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 4 # E: 4 (SGN-U324291,SGN-U337995,SGN-U341412,SGN-U343620) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 3876 14687 1 - . ID=g2 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 3876 14687 . - . ID=g2.t1;Parent=g2 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 3876 3878 . - 0 Parent=g2.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 3876 3959 . - 0 ID=g2.t1.cds;Parent=g2.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 4188 7153 . - 2 ID=g2.t1.cds;Parent=g2.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 14636 14687 . - 0 ID=g2.t1.cds;Parent=g2.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 14685 14687 . - 0 Parent=g2.t1 # protein sequence = [MRISKMIIREDSVRAKVGLDLRNIRCCSCLLHPCGQMELAAEASVVIERLKDTLSNEITNKRVIENALEDMQRAIADT # NDSEEFKKWAEGCLHSLYYVEDSVESFVLDIAPQNKKWSFLMNHTLLLKNFLGCKLTKKMKRIPSDIKRVINEKHKSTGEQDARRNGTTTYMGDQNGA # EAEDGDIEDHNDEDSAKVRLICPKAQCSYPMIPEREEIVLEVDKKPLRCIDDVPLRLDRENISLGCISDKSMMLDRATHARLIYTYSYDDEELEMFDI # KQEVYDLVERLTTTADDGRPPIVQIAGKMGSGKTTLARAIYRNRNIRNHFESGCAWVTISKKFNKPDILQNLLKQMGDSKDSVDLTTNELESRLLECF # NKEKYLIVLDDVQSEQMWEELRSVFLGSRNGSKLLLITTSVSPMWYVSPPNCIHKVKKLKKNYSWNLFMKKAGWDTWELGNEHQDSKQRVLDVCSGLP # LNIVLLGSMLSTKGDTNRFDYLQKMLRTNWETKDIVSLSYTDLPDHLKLCVLYLVLFPKEYDIPVRRLFRLWLSEGFVNPKPDKFPEDVVQENFDDLV # KRSLIQISKFRSDGSPRRCRLLGVLHDYLLPKAQNIKFFHVHCSTCSTEDTVLLNVRRLVEHASSRDIYSDASRFKHLRSYLSFNFQRKDTPAKEVGI # LLTSVITKGFGLLRVLDLEGVYKPSLPENLGELFHLRYLGLRWTFLDALPSSVGDLPYLETLDVKHTNINNLPTSMWKSKKLRHLNLSHIRLDMPQHS # DTNSLPTLLTLWGLSVDDDSPVKNGLDRLCNLREAGITFCLTDCDHLLNWISNLTSLQSLRLRSINDVGHPSRFGNQPLSLSKLSNLSHLNLLGKLPN # LPENLPQGLKVVTLSLSKLTDDPMPILGKLQHLNVLRLLSDSYMGKEMVCPQRGFKELRVLKIWKLKNLEKWDVEEAAMEKLKEINIRCCYKLMSIPK # ILRKKTSLRELIITNMPEEFKQNVNKYMRSRDLILTFKDYDFTPLPCISKATSIRAVLPFIIDYHIQSFDANQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 20 # CDS exons: 1/3 # E: 1 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 6 # E: 6 (SGN-U339883,SGN-U342192,SGN-U340175,SGN-U342742,SGN-U316489,SGN-U333075) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 15301 22094 1 + . ID=g3 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 15301 22094 . + . ID=g3.t1;Parent=g3 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 15301 15303 . + 0 Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 15301 15930 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 19373 19424 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 19849 19884 . + 2 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 20121 20308 . + 2 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 20530 20719 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 20975 21363 . + 2 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 21783 22094 . + 0 ID=g3.t1.cds;Parent=g3.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 22092 22094 . + 0 Parent=g3.t1 # protein sequence = [MFKCEFPKRARRRLPFKPPVLMKSTENRNVSMISTMPELLRWTFLVYDSLTTDEDIVLFVKGLNNRQGINREPNEFNC # IFGYGGNNVIRTNVTSSIQEVFRCNRPDPNVLGGEGVSISLENLLPVPMVVPSVAYYNAPRKLATNKKSEKARLCACTMVYNVGKFLKEWVVYHSKIG # VEKFVLYDNASDDDLGKVVDELVHDGYDVKTYFWIIEDYDEDMTSRSNNSAVHARGNSSDSGSGNGRKEGFFRSKKSGESNNQNNNVARSFAFKELAI # ATQSFRETNLIGEGGFGSVYKGRIDSGQIVAIKQLNLEGLQGNQEFVVEVLMLSLMHHNNLVNLIGYCTHGEQRLLVYEFMPLGSLENHLFDLEPGTT # PLSWKTRLKIAAGAAHGLEYLHKANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGKLTLKSDIYSFGVV # LLELITGRKAYDRTKKQGEQNLVVWSNPFLKDRRKYIHLVDPMLDGQFSSRCLHHAVAVTAMCLQEQASFRPSITDIVTALDYLLLQAQHSGTSRGGS # QSDKHIPPPSTEEFNVSSRNRSYDNMAITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 76.9 # CDS exons: 5/7 # E: 5 # CDS introns: 5/6 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U325887,SGN-U341066,SGN-U325968) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 25035 31826 1 + . ID=g4 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 25035 31826 . + . ID=g4.t1;Parent=g4 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 25035 25037 . + 0 Parent=g4.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 25035 25533 . + 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 29473 29637 . + 2 ID=g4.t1.cds;Parent=g4.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 30365 30600 . + 2 ID=g4.t1.cds;Parent=g4.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 31186 31300 . + 0 ID=g4.t1.cds;Parent=g4.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 31702 31826 . + 2 ID=g4.t1.cds;Parent=g4.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 31824 31826 . + 0 Parent=g4.t1 # protein sequence = [MSNSGSINSPASLSPPENQPLEINIVDSDFVVILAALLCGLICVIGLVAVARCAWIRRITGGNSDDSPFPPANKGLKK # KVLKSLPKFSYTPEQSVQFSECAICLMEFVIGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVSRCSMCGELPVMNSSAAVGDLSHDEFKKM # YLGLKVQNERRSNDEFIYSDFVDLPKSVDWRKKGAVTDVKNQGSCGSCWAFSTVAAVEGINQIRTGNLTSLSEQELIDCDTKYNSGCNGGLMDYAFQF # IVSQGGLHKEDDYPYLMEEGTCDEKRDESEVVTIDGYHDVPVNDEQSLLKALANQPLSVAIEASVDILSKPWNYECRVCLMDIVEQHWIMEWQQLDMD # PQKGWIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 22.2 # CDS exons: 1/5 # E: 1 # CDS introns: 1/4 # E: 1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 4 # E: 4 (SGN-U325968,SGN-U342047,SGN-U344192,SGN-U346649) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 33884 37486 1 - . ID=g5 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 33884 37486 . - . ID=g5.t1;Parent=g5 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 33884 33886 . - 0 Parent=g5.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 33884 34129 . - 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 34747 34908 . - 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 35434 35565 . - 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 35997 36049 . - 2 ID=g5.t1.cds;Parent=g5.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 37006 37486 . - 0 ID=g5.t1.cds;Parent=g5.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 37484 37486 . - 0 Parent=g5.t1 # protein sequence = [MSVTEAGSGVMTSRDHFSVAGVQNSPSNVPATTPVVQNMHLGYRDENTAVFAPPPYQSAEGSAGAGTSMLQNLNNNSS # EPMKRKRGRPRKYGPDGSMALGLNPAASPVGGGSLGGSLSPRDPGNSAGAQMHSGGPGSPNSSKKGRGRPPGSGKKQQMDNLGSTGFGFTPHIIAVKP # GEDVAYKIMSFSQNGPRAVCILSASGAISYVTLKQTATSGGTATYEGRFEILSLSGSFMLSDIGGQQSRTGGLSVSLAGSDGRILGGCVAGVLTAASP # VQVIVGSFIADGRKEPKTSNHFEVLPAPLNANLGVGGGLTGANSPPSRGTYSESSGGPGSPINQRGPVCTNDNLQGISSMPWK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 5/5 # E: 5 # CDS introns: 4/4 # E: 4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U325968,SGN-U318876) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 39517 51881 1 + . ID=g6 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 39517 51881 . + . ID=g6.t1;Parent=g6 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 39517 39519 . + 0 Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 39517 39643 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 39720 39786 . + 2 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 40533 40642 . + 1 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 40727 40792 . + 2 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 46718 47003 . + 2 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 47092 47131 . + 1 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 50680 50731 . + 0 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 50960 51026 . + 2 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 51686 51881 . + 1 ID=g6.t1.cds;Parent=g6.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 51879 51881 . + 0 Parent=g6.t1 # protein sequence = [MATLSSSSSSSSSSSSPCLNQYQYQAILRLPRVPLISSHLLKVPKKNRNSLIFCCNNTVPDSRTGEQVKGECLTKRRE # LLLQAGSVAFSLSAFTSIALAEKDVPEEFRVYSDDVNKFKIMIPSVVRIDKSEEEMVVDRSEDPQMKTNAAIVIADDDARSDQFPKVTTKVTDSIALI # GEDDEGSPEHQAEFIEKLGSFYQEKAMEFKQPGFYGHPLNCLKLWRSVIKLGGYDQDGSSYNTPKRAKSQKTSGSHEGQNEEGQPMKVAKAKTSQPWS # PYLLELISFGPTVMSPFMGVFTFMCPLSRKISESTKQEHCECLAKEHCECWAKEVLRLQPPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 41.2 # CDS exons: 4/9 # E: 4 # CDS introns: 3/8 # E: 3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 1 # E: 1 (SGN-U344695) # incompatible hint groups: 1 # E: 1 (SGN-U325968) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 49193 64213 2 - . ID=g7 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 49193 64213 . - . ID=g7.t1;Parent=g7 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 49193 49195 . - 0 Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 49193 49209 . - 2 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 49436 49548 . - 1 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 51699 51768 . - 2 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 56447 56559 . - 1 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 58709 58851 . - 0 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 63110 63158 . - 1 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 64086 64213 . - 0 ID=g7.t1.cds;Parent=g7.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 64211 64213 . - 0 Parent=g7.t1 # protein sequence = [MLANYKYSCFVDSDILLRKGHMNMKTPVKGETSDGPKLINSSREPEYDKKFCCGHYSFLHSQCSFAKHSQCSCFVDSE # IFLLKGHMNMKTPMKGDITVGPKLINSSSPYSLSCSESVRVSNTSVDLDVGSFMIRFGDMNLRRDTGHMNVKTPMKGDITVGPKLINSSSPYSLSCSE # SVRVSNTGVDLDVGSFMIRFGDMNLRRDTAPKIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U325968,SGN-U315798) C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 56204 64213 . - . ID=g7.t2;Parent=g7 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 56204 56206 . - 0 Parent=g7.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 56204 56220 . - 2 ID=g7.t2.cds;Parent=g7.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 56447 56559 . - 1 ID=g7.t2.cds;Parent=g7.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 58709 58851 . - 0 ID=g7.t2.cds;Parent=g7.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 63110 63158 . - 1 ID=g7.t2.cds;Parent=g7.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 64086 64213 . - 0 ID=g7.t2.cds;Parent=g7.t2 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 64211 64213 . - 0 Parent=g7.t2 # protein sequence = [MLANYKYSCFVDSDILLRKGHMNMKTPVKGETSDGPKLINSSREPEYDKKFCCGHYSFLHSQCSFAKHSQCSCFVDSE # IFLLKGHMNMKTPMKGDITVGPKLINSSSPYSLSCSESVRVSNTSVDLDVGSFMIRFGDMNLRRDTAPKIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 2 # E: 2 (SGN-U325968,SGN-U315798) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 71035 76155 1 + . ID=g8 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 71035 76155 . + . ID=g8.t1;Parent=g8 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 71035 71037 . + 0 Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 71035 71261 . + 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 71350 71389 . + 1 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 74444 74578 . + 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 74996 75047 . + 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 75221 75293 . + 2 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 75531 75597 . + 1 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 76051 76155 . + 0 ID=g8.t1.cds;Parent=g8.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 76153 76155 . + 0 Parent=g8.t1 # protein sequence = [MKTNAATLTTDGDARSDQFPKVTIEVKDSSAFIGDDDEGSFEDQAVFIEKLGTFYQEKAVELKLPRFYGHRLNCLKLW # RSVIKLGGYDQLLLQYERHMTQIGELQLPIAPSPVDNENSVDNENSYERHMTQIGEDGSAYNTPKRAKSRKTSGSLKHQGKKEADQQTKAAETETFKP # LDVQVVDVGPPADWVKINVRETVVTLPARIDHLRTNGDVTLHGCLHVHMPFAQKDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/7 # CDS introns: 0/6 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U325968,SGN-U315798,SGN-U319540) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 77366 79310 1 - . ID=g9 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 77366 79310 . - . ID=g9.t1;Parent=g9 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 77366 77368 . - 0 Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 77366 77392 . - 0 ID=g9.t1.cds;Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 78194 78238 . - 0 ID=g9.t1.cds;Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 78364 78482 . - 2 ID=g9.t1.cds;Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 78850 78925 . - 0 ID=g9.t1.cds;Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 79029 79111 . - 2 ID=g9.t1.cds;Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 79199 79310 . - 0 ID=g9.t1.cds;Parent=g9.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 79308 79310 . - 0 Parent=g9.t1 # protein sequence = [MMLTDEELLADWQIGAGEGDGVRSLLAFYPPEASNSNVSIVITSLGADFTKLESFGKVDAFAENLVSGFDRSWQRPPG # VKAKLIDSKASKGLYYIEYTLQNPGESLRHLFSVLGIANNGIYNRLYTLTGQFVDEEAEKYGAKIQKAVSSFRLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 100 # CDS exons: 6/6 # E: 6 # CDS introns: 5/5 # E: 5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 3 # E: 3 (SGN-U325968,SGN-U315798,SGN-U325341) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 91594 102308 1 - . ID=g10 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 91594 102308 . - . ID=g10.t1;Parent=g10 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 91594 91596 . - 0 Parent=g10.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 91594 91967 . - 2 ID=g10.t1.cds;Parent=g10.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 99981 100093 . - 1 ID=g10.t1.cds;Parent=g10.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 102244 102308 . - 0 ID=g10.t1.cds;Parent=g10.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 102306 102308 . - 0 Parent=g10.t1 # protein sequence = [MNVKTPMKGDITVGPKLINSSSPYSLSCSESVWVSNTSVDLDVGSFMIRFGDMNLRRDTGGEKKVFPPKKPYNLKKNE # KKKIWIFFFPQKKKKIFFFLTKKKKKLNKFWVVFPKKKKKKKKKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPSLHHWPPPGKKNLSPP # NFFSKER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 20 # CDS exons: 1/3 # E: 1 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 41 # E: 41 (SGN-U312450,SGN-U312649,SGN-U326390,SGN-U333388,SGN-U342802,SGN-U313399,SGN-U340506,...) # incompatible hint groups: 27 # E: 27 (SGN-U315798,SGN-U338366,SGN-U341031,SGN-U340180,SGN-U342450,SGN-U328100,SGN-U334188,...) ### ### C12HBa0165F06.1 AUGUSTUS_tom_ugs gene 107129 111403 1 + . ID=g11 C12HBa0165F06.1 AUGUSTUS_tom_ugs transcript 107129 111403 . + . ID=g11.t1;Parent=g11 C12HBa0165F06.1 AUGUSTUS_tom_ugs start_codon 107129 107131 . + 0 Parent=g11.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 107129 107385 . + 0 ID=g11.t1.cds;Parent=g11.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 107474 107513 . + 1 ID=g11.t1.cds;Parent=g11.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 111053 111104 . + 0 ID=g11.t1.cds;Parent=g11.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs CDS 111333 111403 . + 2 ID=g11.t1.cds;Parent=g11.t1 C12HBa0165F06.1 AUGUSTUS_tom_ugs stop_codon 111401 111403 . + 0 Parent=g11.t1 # protein sequence = [MVVDRSEDPQMKTNAAIVIADDDARSDQFPKVTTKVTDSSALIGEDDEGSPEHQAKFIEKLGSFYQEKAMEFKQPRFY # GHPLNCLKLWRSVIKLGGYDQDGSSYNTPKRAKSQKTSGCHERQNEEGQPMKAAKAKTSQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 ### # command line: # /usr/bin/augustus.real --species=human --hintsfile=/tmp/bac-submission-temp-C12HBa0165F06-ZSJOl/AUGUSTUS_tom_ugs/hints.gff --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C12HBa0165F06-ZSJOl/AUGUSTUS_tom_ugs/seq_with_defline_removed