ESTScan Details for Unigene SGN-U202209

Score 
188
Direction 
Forward
Predicted Peptide Sequence 
NNSFHLRLRLAMAKNRNKKRNGPAAMDVSTDQTVTGPQAMDTSESAAPKQNIGGSHRKTKGVQMKRTKNVRKMKAIAKAXFKK
Predicted Coding Sequence 
XXGAACAATTCCTTCCATCTTCGCCTTCGTTTAGCTATGGCGAAGAACAGAAACAAGAAGAGAAATGGCCCTGCTGCTATGGATGTTTCC
ACTGACCAGACGGTCACGGGTCCCCAGGCAATGGATACTTCAGAATCAGCAGCTCCAAAACAAAATATAGGTGGATCACATAGAAAGACC
AAGGGAGTACAGATGAAAAGGACAAAGAATGTACGGAAAATGAAAGCCATCGCAAAGGCTXATTTCAAAAAGTGA\
Edits in Original Sequence 
(5')XXGAACAATTCCTTCCATCTTCGCCTTCGTTTAGCTATGGCGAAGAACAGAAACAAGAAGAGAAATGGCCCTGCTGCTATGGATGT
TTCCACTGACCAGACGGTCACGGGTCCCCAGGCAATGGATACTTCAGAATCAGCAGCTCCAAAACAAAATATAGGTGGATCACATAGAAA
GACCAAGGGAGTACAGATGAAAAGGACAAAGAATGTACGGAAAATGAAAGCCATCGCAAAGGCTXATTTCAAAAAGTGA\(3')GAAATT
GGACGAAAGAATCACTAGGAGCGAAAGCAAGATAGAGAGAACGAAAGATGCCAAAAAAATTATACGAGTGAATAGTTCTTTCCTTGTGAT
TCTAATTCTGAATGAGTGGTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan