ESTScan Details for Unigene SGN-U220447

Score 
711
Direction 
Forward
Predicted Peptide Sequence 
KXVIRKLFFIYNFPYALDELLEIRDRTSVGSIHHGRDGAMPEIGGFRQKSRRSFVTLILTVLTSSQSILIVWSKRAGKYEYSVTTANXSG
RGIEMCIVACGLAKNLEKDGVTDDNRLSTTWDEVKVYPIPAALYLVKNLLQYYIFAYVDAPGYQILKNLNIISTGILYQIILKRKLTEIQ
WAAFILLCAGCTTAQLNPSSDHVLQAPLQGWVMAIVMALLSGFAGVYTEAIIKKRPSRNINVQNFWLYVFGMIFNAFAIMTQDFDAVMND
GFFHGYSLITVLMILNHALSGIAVSMVMKYADNIVKVYSTSVAMLLTAVVSVFLFGFHLSLAFFLGSTVVSERYIYTRPAKPEDNNHLHL
RALLLKTWPWSGVELAFEFRTEEYLDDLLISVNSDSNSSVNRPSKGIRT
Predicted Coding Sequence 
AAAXCTGTGATTCGGAAGCTCTTCTTCATCTACAATTTTCCCTATGCGCTCGACGAATTGCTTGAAATTCGGGATCGAACAAGTGTAGGA
AGCATACATCATGGCCGCGATGGAGCAATGCCGGAGATTGGTGGCTTCCGACAGAAAAGCCGAAGGTCATTTGTAACACTTATTCTGACA
GTTCTTACGAGTTCACAATCGATTCTCATTGTTTGGTCGAAGAGAGCTGGGAAGTATGAGTACAGTGTAACCACTGCAAATXTTTCTGGT
AGAGGCATTGAAATGTGCATTGTCGCTTGTGGCCTTGCTAAGAATCTGGAGAAGGATGGCGTTACTGATGATAACAGGTTGAGCACTACG
TGGGATGAAGTTAAAGTGTATCCTATTCCTGCTGCACTTTACCTTGTCAAGAATCTACTTCAGTATTACATTTTTGCGTATGTAGATGCT
CCTGGATATCAGATACTGAAGAACTTGAATATTATCAGCACTGGCATATTGTATCAAATTATTCTCAAAAGGAAGTTAACTGAAATTCAG
TGGGCTGCTTTCATTCTACTTTGTGCTGGGTGCACCACTGCACAGCTTAATCCTAGTTCTGATCATGTTCTTCAGGCTCCTTTACAAGGT
TGGGTTATGGCTATTGTAATGGCCCTTTTGAGTGGTTTTGCCGGAGTTTACACAGAGGCTATAATTAAGAAGAGACCGTCAAGAAATATA
AATGTTCAGAACTTCTGGTTGTATGTCTTTGGAATGATCTTCAATGCTTTTGCAATAATGACTCAAGATTTTGATGCAGTCATGAATGAT
GGGTTCTTCCATGGATATTCACTGATTACAGTTCTCATGATTCTCAACCACGCACTAAGTGGTATTGCAGTATCAATGGTGATGAAGTAT
GCTGACAATATTGTGAAGGTCTATTCAACTTCAGTCGCAATGCTACTGACTGCAGTTGTTTCTGTATTTCTGTTTGGATTTCACCTTTCC
CTTGCCTTTTTCCTTGGTTCCACCGTTGTTTCTGAGCGATATATTTACACTCGACCAGCAAAGCCCGAAGATAACAACCACCTTCACCTT
CGAGCTCTCTTGCTTAAAACTTGGCCTTGGAGTGGAGTGGAGTTGGCATTTGAATTTCGGACTGAAGAATACTTGGATGATCTCCTCATT
TCTGTCAATTCTGATTCAAATAGCAGTGTTAATCGCCCCAGCAAAGGTATTAGAACATAA\
Edits in Original Sequence 
(5')AAAXCTGTGATTCGGAAGCTCTTCTTCATCTACAATTTTCCCTATGCGCTCGACGAATTGCTTGAAATTCGGGATCGAACAAGTGT
AGGAAGCATACATCATGGCCGCGATcGGAGCAATGCCGGAGATTGGTGGCTTCCGACAGAAAAGCCGAAGGTCATTTGTAACACTTATTC
TGACAGTTCTTACGAGTTCACAATCGATTCTCATTGTTTGGTCGAAGAGAGCTGGGAAGTATGAGTACAGTGTAACCACTGCAAATXTTT
CTGGTAGAGGCATTGAAATGTGCATTGTCGCTTGTGGCCTTGCTAAGAATCTGGAGAAcGGATGGCGTTACTGATGATAACAGGTTGAGC
ACTACGTGGGATGAAGTTAAAGTGTATCCTATTCCTGCTGCACTTTACCTTGTCAAGAATCTACTTCAGTATTACATTTTTGCGTATGTA
GATGCTCCTGGATATCAGATACTGAAGAACTTGAATATTATCAGCACTGGCATATTGTATCAAATTATTCTCAAAAGGAAGTTAACTGAA
ATTCAGTGGGCTGCTTTCATTCTACTTTGTGCTGGGTGCACCACTGCACAGCTTAATCCTAGTTCTGATCATGTTCTTCAGGCTCCTTTA
CAAGGTTGGGTTATGGCTATTGTAATGGCCCTTTTGAGTGGTTTTGCCGGAGTTTACACAGAGGCTATAATTAAGAAGAGACCGTCAAGA
AATATAAATGTTCAGAACTTCTGGTTGTATGTCTTTGGAATGATCTTCAATGCTTTTGCAATAATGACTCAAGATTTTGATGCAGTCATG
AATGATGGGTTCTTCCATGGATATTCACTGATTACAGTTCTCATGATTCTCAACCACGCACTAAGTGGTATTGCAGTATCAATGGTGATG
AAGTATGCTGACAATATTGTGAAGGTCTATTCAACTTCAGTCGCAATGCTACTGACTGCAGTTGTTTCTGTATTTCTGTTTGGATTTCAC
CTTTCCCTTGCCTTTTTCCTTGGTTCCACCGTTGTTTCTGtAGCGATATATTTACACTCGACCAGCAAAGCCCGAAGATAACAACCACCT
TCACCTTCtGAGCTCTCTTGCTTAAAACTTGGCCTTGGAGTGGAGTGGAGTTGGCATTTGAATTTCGGACTGAAGAATACTTGtGATGAT
CTCCTCATTTCTGTCAATTCTGaATTCAAATAGCAGTGTTAATCGCCCCAGCAAAGGTATTAGAACATAA\(3')GGACTTTCTTGGATT
TGAAGTATAAATATCAATTTAAGTTATATGTATGAAATTTTTTAATTCTGCATTTAAATGAGAAACATTAATCATTTTTGTTATTCATTT
TTGCACATATTAATATATCATATGTATGGATCTAATAACTTAAAAATGTAACTCGTTATTTTAGTTACCAAACAAAATTTTGCAAGTTAA
AAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan