ESTScan Details for Unigene SGN-U230035

Score 
76
Direction 
Forward
Predicted Peptide Sequence 
SFCLYDTRGLSDDLNENKKIVDRWMKKGVRHGKLITRDSDDAHPSLKFAEIDTVPVRPMWLIVSYLLSVRSKFYXSMDSDDETKRQQTRA
VATNFNYPLLSFKDEKPIVVLTHGDLLSLLDLRAPHAFGTAAGIHPKKQIFDIPGDIKKVSLLDMNLFKLNKTLTTPNPRSIFLLXGLVF
SDSDDFATRXDYTQHAAAIVSSVLIKTYPSKKTTFSX
Predicted Coding Sequence 
XGTTCTTTCTGTTTGTATGACACACGTGGTCTGTCGGATGATTTGAATGAAAATAAGAAAATTGTGGACCGCTGGATGAAAAAGGGGGTT
CGTCATGGGAAGCTAATAACCAGGGATTCTGATGATGCACATCCAAGTCTGAAGTTCGCCGAAATAGATACTGTGCCAGTGAGACCAATG
TGGTTAATTGTGTCATATTTGTTGTCAGTGCGGTCCAAATTCTACAAXTCGATGGACAGCGATGATGAAACAAAAAGGCAACAAACTCGA
GCTGTTGCTACAAATTTCAACTACCCTCTCTTGTCATTCAAAGATGAAAAACCTATTGTTGTGCTCACACATGGTGATTTACTTTCACTT
TTGGATCTACGCGCTCCGCATGCATTTGGGACAGCTGCTGGTATTCATCCCAAGAAACAAATTTTTGATATCCCAGGTGACATCAAGAAA
GTTAGCCTGCTAGACATGAATTTGTTTAAGTTGAACAAAACTCTAACCACCCCGAACCCCCGTTCTATTTTTCTCCTTGXTGGTCTTGTG
TTTTCAGATAGTGATGATTTTGCAACTAGGXTTGACTATACTCAACATGCTGCXGCCATTGTCTCGAGCGTGCTGATAAAAACCTACCCT
TCAAAAAAGACTACCTTTTCAAAX\
Edits in Original Sequence 
(5')XGTTCTTTCTGTTTGTATGACACACGTGGTCTGTCGGATGATTTGAATGAAAATAAGAAAATTGTGGACCGCTGGATGAAAAAGGG
GGTTCGTCATGGGAAGCTAATAACCAGGGATTCTGATGATGCACATCCgAAGTCTGAAGTTCGCCGAAATAGATACTGTGCCAGTGAGAC
CAATGTGGTTAATTGTGTCATATTTGTTGTCAGTGCGGTCCAAATTCTACAAXTCGATGGACAGCGATGATGAAACAAAAAGGCAACAAA
CTCGAGCTGTTGCTACAAATTTCAACTACCCTCTCTTGTCATTCAAAGATGAAAAACCTATTGTTGTGCTCACACATGGTGATTTACTTT
CACTTTTGGATCgTACGCGCaTCCGCATGCATTTGGGACAGCTGCTgGGTATTCATCCCAAGAAACAAATTTTTGATATCCCAGGTGACA
TCAAGAtAAGTTAGCCTGCTAGtACATGAATTTGTTTAAGTTGAACAAAACTCTAACCACCCCGAACCCCCGTTCTATTTTTCTCCTTGX
TGGTCTTGTGTTTTCAGATAGTGATGATTTTGCAACTAGGXTTGACTATACTCAACATGCTGCXGCCATTGTCTCGAGCGTGCTGATAAA
AACCTACCCTTCAAAAAAGACTACCTTTTCAAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan