ESTScan Details for Unigene SGN-U249515

Score 
794
Direction 
Forward
Predicted Peptide Sequence 
QVNYFNTNPYQFSRKSEANMLRILGKNLRISKSATIVVRSESEIDAHDLFDELSSWEFVNPSDDEQEDSYSFTDQTDDDVELMLKEDDPC
EIGSPSSDISMKSEAESGSPSPVQTIDALVVCPVGFNHHDTSRDDDQEEDDEEEEEEEEEDYDYDLDDELVPNWLSDKLGRQRIRKLGKR
ACSKMNKSRKAPYVFNRPGCVHGKHGFGMR
Predicted Coding Sequence 
XCTCAAGTAAACTACTTCAATACAAACCCTTATCAATTTTCAAGAAAATCAGAAGCCAATATGTTGAGAATCCTTGGAAAAAATCTCAGA
ATTTCAAAATCAGCAACAATTGTTGTTAGATCAGAGTCAGAAATTGATGCGCATGATCTGTTTGATGAATTGTCTTCGTGGGAATTTGTT
AACCCTTCTGATGATGAACAAGAAGACAGCTACTCCTTCACTGATCAAACTGATGATGATGTTGAATTGATGTTAAAAGAAGATGACCCA
TGTGAAATTGGGTCTCCATCTTCTGATATCTCGATGAAATCGGAAGCAGAATCCGGATCTCCGTCGCCAGTTCAAACAATTGATGCATTG
GTGGTTTGCCCTGTTGGGTTCAATCATCATGATACTTCTCGTGATGATGATCAGGAGGAGGACGATGAAGAGGAAGAGGAGGAGGAAGAA
GAAGATTATGACTATGATTTGGATGATGAGTTGGTGCCAAATTGGTTGAGTGATAAACTTGGGAGACAAAGGATTAGGAAATTGGGGAAA
AGGGCTTGTTCCAAGATGAACAAATCCAGAAAGGCGCCTTATGTTTTTAATAGGCCTGGATGTGTTCATGGTAAACATGGATTTGGTATG
CGGTAG\
Edits in Original Sequence 
(5')XCTCAAGTAAACTACTTCAATACAAACCCTTATCAATTTTCAAGAAAATCAGAAGCCAATATGTTGAGAATCCTTGGAAAAAATCT
CAGAATTTCAAAATCAGCAACAATTGTTGTTAGATCAGAGTCAGAAATTGATGCGCATGATCTGTTTGATGAATTGTCTTCGTGGGAATT
TGTTAACCCTTCTGATGATGAACAAGAAGACAGCTACTCCTTCACTGATCAAACTGATGATGATGTTGAATTGATGTTAAAAGAAGATGA
CCCATGTGAAATTGGGTCTCCATCTTCTGATATCTCGATGAAATCGGAAGCAGAATCCGGATCTCCGTCGCCAGTTCAAACAATTGATGC
ATTGGTGGTTTGCCCTGTTGGGTTCAATCATCATGATACTTCTCGTGATGATGATCAGGAGGAGGACGATGAAGAGGAAGAGGAGGAGGA
AGAAGAAGATTATGACTATGATTTGGATGATGAGTTGGTGCCAAATTGGTTGAGTGATAAACTTGGGAGACAAAGGATTAGGAAATTGGG
GAAAAGGGCTTGTTCCAAGATGAACAAATCCAGAAAGGCGCCTTATGTTTTTAATAGGCCTGGATGTGTTCATGGTAAACATGGATTTGG
TATGCGGTAG\(3')TTATGTCTAAAGTAAATAATTTGCATGTTCAATATGGATGAACAAAAAATGGGAAGTTAAGTTTTAGGCTAATTG
ATTAACTGGAAGCATTGTTGATTTTATCTGAATATAATCTTGATGTAATTAGGGCTGGTGGAAATTAAGTTGCTATCTAATTTGCAACTC
TTTAGCTTGCTTTTTAGGCCTAGGTTATCTACTTGAATTTGGATGTAAATATTTGAATTTATCTAATGCAATTTGAATTTCAAGATCCAA
AAAAAAGGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan