ESTScan Details for Unigene SGN-U251361

Score 
629
Direction 
Forward
Predicted Peptide Sequence 
RETSEEMKEAKRSRKRKRGKVHKKSTTQAGDDPSKVSGVNQSMVSNVAISKTKKPLSFLDKMKARLSGGHFRMLNEKLYTCSGDEALNYF
KENPELFNVYHAGYQEQMLHWPEKPVNIITKWLKDHSPSLIVADFGCGDARLARSVKNKVWSLDLVAHDPSVIACDMSNTPLEASSVDVA
IFCLSLMGTDYPSFLQEALRVLKPRGWLLIAEVKSRLDPTTGGADPNNFLKAICELGFTIESKDFSNXMFVLFYFKKKENRIXVTRDYWP
X
Predicted Coding Sequence 
AGAGAAACTTCAGAGGAGATGAAAGAAGCAAAGCGGAGTCGTAAACGGAAGAGAGGAAAGGTTCATAAGAAGTCTACTACTCAGGCCGGA
GACGATCCTTCTAAGGTCTCCGGCGTGAATCAGTCTATGGTTTCGAATGTGGCGATCTCAAAAACTAAGAAACCTTTGTCTTTTCTCGAT
AAGATGAAGGCGAGATTATCAGGAGGACACTTCCGTATGCTTAATGAAAAACTCTACACTTGCTCTGGAGATGAGGCGCTCAATTATTTC
AAGGAAAATCCGGAACTTTTTAATGTGTATCATGCAGGGTATCAGGAGCAAATGTTACATTGGCCAGAAAAACCTGTTAATATAATCACA
AAATGGCTAAAGGATCATAGCCCTTCATTAATTGTTGCTGACTTTGGCTGTGGAGATGCACGGCTGGCAAGAAGTGTGAAGAACAAAGTG
TGGTCTTTGGATCTTGTTGCACATGATCCTTCAGTCATTGCTTGTGACATGTCAAATACCCCTCTAGAGGCCTCGTCAGTTGATGTGGCC
ATCTTTTGCCTTTCATTGATGGGAACCGATTATCCAAGCTTTCTTCAGGAAGCACTCAGAGTTCTTAAACCCAGGGGGTGGCTTTTGATA
GCAGAAGTTAAAAGCAGGCTTGATCCAACTACAGGAGGAGCAGACCCAAACAATTTTTTGAAAGCTATTTGTGAGCTTGGGTTTACCATC
GAGTCAAAGGATTTCTCTAACAAXATGTTTGTGCTGTTCTACTTTAAGAAAAAGGAAAACAGAATTCNNGTAACAAGAGATTATTGGCCT
GXX\
Edits in Original Sequence 
(5')AGAGAAACTTCAGAGGAGATGAAAGAAGCAAAGCGGAGTCGTAAACGGAAGAGAGGAAAGGTTCATAAGAAGTCTACTACTCAGGC
CGGAGACGATCCTTCTAAGGTCTCCGGCGTGAATCAGTCTATGGTTTCGAATGTGGCGATCTCAAAAACTAAGAAACCTTTGTCTTTTCT
CGATAAGATGAAGGCGAGATTATCAGGAGGACACTTCCGTATGCTTAATGAAAAACTCTACACTTGCTCTGGAGATGAGGCGCTCAATTA
TTTCAAGGAAAATCCGGAACTTTTTAATGTGTATCATGCAGGGTATCAGGAGCAAATGTTACATTGGCCAGAAAAACCTGTTAATATAAT
CACAAAATGGCTAAAGGATCATAGCCCTTCATTAATTGTTGCTGACTTTGGCTGTGGAGATGCACGGCTGGCAAGAAGTGTGAAGAACAA
AGTGTGGTCTTTGGATCTTGTTGCACATGATCCTTCAGTCATTGCTTGTGACATGTCAAATACCCCTCTAGAGGCCTCGTCAGTTGATGT
GGCCATCTTTTGCCTTTCATTGATGGGAACCGATTATCCAAGCTTTCTTCAGGAAGCACTCAGAGTTCTTAAACCCAGGGGGTGGCTTTT
GATAGCAGAAGTTAAAAGCAGGCTTGATCCAACTACAGGAGGAGCAGACCCAAACAATTTTTTGAAAGCTATTTGTGAGCTTGGGTTTAC
CATCGAGTCAAAGGATTTCTCTAACAAXATGTTTGTGCTGTTCTACTTTAAGAAAAAGGAAAACAGAATTCNNGTAACAAGAGATTATTG
GCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan