ESTScan Details for Unigene SGN-U257311

Score 
468
Direction 
Forward
Predicted Peptide Sequence 
TVSNNLFISSNLKIQLLSTLPDAFLINPSSKMQGPWLPVSRPDPLSGSPDPETVKFLQGLVTNDLRRLENPQPEDRTTLATTNAPFVSVP
PVYAALLTPQGRFLYDMFLYRPPRADEKLDRTGSGPGPDSGELELFADVDGSELDELLQTLKKYRLRSKVEIESMANDFSCWQKVGPDLT
QKSSEEPDAALPGWGGGVDRSGQS
Predicted Coding Sequence 
XGTACCGTTTCAAACAATCTCTTCATTTCTTCAAACCTAAAAATTCAACTTTTATCAACTCTTCCAGACGCTTTTCTCATCAATCCCAGC
TCGAAAATGCAGGGCCCATGGCTTCCCGTCTCAAGACCCGATCCGTTATCCGGTTCACCGGACCCXGAAACCGTTAAATTCCTTCAGGGT
CTTGTTACCAATGATCTACGGAGGCTAGAAAATCCACAACCCGAAGATAGGACCACTTTAGCTACTACCAATGCCCCGTTCGTTTCGGTT
CCTCCGGTGTATGCTGCTCTTTTGACTCCTCAAGGAAGGTTTTTGTATGATATGTTCTTGTATAGGCCGCCTCGGGCTGATGAGAAGCTT
GATCGGACTGGTTCCGGGCCTGGCCCTGATTCTGGGGAGCTGGAATTGTTTGCTGATGTTGATGGTTCTGAATTGGATGAGCTTCTGCAA
ACACTGAAAAAGTATCGGTTGAGGTCTAAGGTTGAAATAGAGAGCATGGCCAATGATTTCTCTTGTTGGCAGAAGGTTGGCCCAGATTTA
ACTCAGAAATCCTCTGAAGAGCCGGATGCTGCXCTCCCTGGATGGGGTGGTGGGGTTGATCGCTCTGGCCAGTCA\
Edits in Original Sequence 
(5')XGTACCGTTTCAAACAATCTCTTCATTTCTTCAAACCTAAAAATTCAACTTTTATCAACTCTTCCAGACGCTTTTCTCATCAATCC
CAGCTCGAAAATGCAGGGCCCATGGCTTCCCGTCTCAAGACCCGATCCGTTATCCGGTTCACCGGACCCXGAAACCGTTAAATTCCTTCA
GGGTCTTGTTACCAATGATCTACGGAGGCTAGAAAATCCACAACCCGAAGATAGGACCACTTTAGCTACTACCAATGCCCCGTTCGTTTC
GGTTCCTCCGGTGTATGCTGCTCTTTTGACTCCTCAAGGAAGGTTTTTGTATGATATGTTCTTGTATAGGCCGCCTCGGGCTGATGAGAA
GCTTGATCGGACTGGTTCCGGGCCTGGCCCTGATTCTGGGGAGCTGGAATTGTTTGCTGATGTTGATGGTTCTGAATTGGATGAGCTTCT
GCAAACACTGAAAAAGTATCGGTTGAGGTCTAAGGTTGAAATAGAGAGCATGGCCAATGATTTCTCTTGTTGGCAGAAGGTTGGCCCAGA
TTTAACTCAGAAATCCTCTGAAGAGCCGGATGCTGCXCTCCCTGGATGGGGTGGTGGGGTTGATCGCTCTGGCCAGTCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan