ESTScan Details for Unigene SGN-U309281

Score 
118
Direction 
Forward
Predicted Peptide Sequence 
VKFKPNIQQQGMKQQKLTERGRNKLLATXGRNSHHHTSGLQEITPAGVSYIKVYPPSSDLAILESFHDNLTLLPNLKEEQGQSSNANQED
DALINYFKVSSIHHXALINYFKSVKDYLDHRYKRRKQEVKRHLKPYEILINHHNVAKXYLEEIASGNMASPFLNDPTVDLLALANA
Predicted Coding Sequence 
GTTAAATTTAAGCCAAATATTCAACAACAAGGCATGAAACAGCAGAAACTTACTGAAAGAGGACGCAATAAACTGCTTGCCACAXTAGGA
AGGAACAGTCATCACCACACTTCTGGTCTGCAAGAAATAACTCCCGCCGGTGTCTCATATATTAAGGTATACCCACCGTCTTCTGACTTG
GCAATACTTGAGAGCTTCCATGACAATTTAACTTTGCTTCCCAACCTAAAAGAAGAACAAGGGCAGAGTAGTAATGCAAACCAAGAAGAT
GATGCACTGATAAATTACTTTAAGGTATCATCAATTCATCATAXAGCACTGATAAATTACTTTAAGTCTGTXAAGGACTACCTTGACCAT
AGATACAAAAGAAGGAAACAAGAAGTTAAAAGGCATCTCAAGCCATATGAAATACTCATAAATCATCATAATGTTGCAAAGXACTACCTT
GAAGAGATCGCATCAGGTAACATGGCCAGTCCCTTCTTAAATGATCCGACTGTTGACCTTTTGGCTTTGGCAAACGCCTGA
Edits in Original Sequence 
(5')GTTAAATTTAAGCCAAATATTCAACaAACAAGGCATGAAACAGCAGAAACTTACTGAAAGAGGACGCAATAAACTGCTTGCCACAX
TAGGAAGGAACAGTCATCACCACACTTCTGGTCTGCAcAGAAATAACTCCCGCCGGTGTCTCATATATTAAGGTATACCCACCGTCTTCT
GACTTGGCAATACTTGAGAGCTTCCATGACAATTTAACTTTGCTTCCCAACCTAAAAGAAGAACAAGGGCAGAGTAGTAATGCAAACCAA
GAAGATGATGCACTGATAAATTACTTTAAGGTATCATCAATTCATCATAXAGCACTGATAAATTACTTTAAGTCTGTXAAGGACTACCTT
GACCATAGATACAAAAGAAGGAAACAAGAAGTTAAAAGGCATCTCAAGCCATATGAAATACTCATAAATCATCATAATGTTGCAAAGXAC
TACCTTGAAGAGATCGCATCAGGTAACATGGCCAGTCCCTTCTTAAATGATCCGACTGtTTGACCTTTTGGCTTTGGCAAACGCCTGA(3')
AGAAGTGCCAAGAGTTAGTGATCTGTACGAGTATGGATTAAAACAGTGAAAAGAAACAACAAAAGGCCGAAAGATGAAATAAATTGTT
ACGGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan