This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
Tomato locus 1-aminocyclopropane-1-carboxylic acid synthase-4
| Locus details | Download GMOD XML | Note to Editors | Annotation guidelines |
[loading edit links...]
|
[loading...]
|
|
Links to external databases
Links to external databases
|
1-aminocyclopropane-1-carboxylic acid synthase-4 is on PhyloGenes
TomDelDB genotype frequencies in tomato populations. chromosome SL2.50ch05, position: 59889621
Please cite Razifard et al.
TomDelDB genotype frequencies in tomato populations. chromosome SL2.50ch05, position: 59889719
Please cite Razifard et al.
TomDelDB genotype frequencies in tomato populations. chromosome SL2.50ch05, position: 59890901
Please cite Razifard et al.
| Registry name: | None | [Associate registry name] |
Notes and figures (0)
Notes and figures (0)
| [Add notes, figures or images] |
Success
The display image was set successfully.
| Image | Description | Type |
|---|
Accessions and images (0)
Accessions and images (0)
| [Associate accession] |
Accession name:
Would you Like to specify an allele?
| Alleles (0) | None | [Add new Allele] |
Associated loci (5)
Associated loci (5)
| [Associate new locus] |
[loading...]
|
Associated loci - graphical view
Associated loci - graphical view
| View 1-aminocyclopropane-1-carboxylic acid synthase-4 relationships in the stand-alone network browser |
[loading...] | [Legend] [Levels] |
SolCyc links
SolCyc links
|
[loading...]
Sequence annotations
Sequence annotations
|
Genome features
Genome features
|
Genomic sequence
Genomic sequence
| unprocessed genomic sequence region underlying this gene |
>Solyc05g050010.2 SL2.50ch05:59888702..59891616
TCTTCCAAACAAAAACTTTTGTACTTCAAATTTCACTAGGCTATTAAACTAAATTCATAAAAATTAGGAAATAATAAAATGGATTTGGAGACGAGTGAGATTTCAAATTACAAGTCATCAGCAGTTTTGTCTAAGTTGGCTAGTAACGAACAACATGGTGAAAACTCACCATATTTTGATGGGTGGAAAGCATACGATAACGACCCTTTCCACTTGGTGAATAATTTGAATGGGGTTATTCAGATGGGTCTCGCGGAAAATCAGCTTTCAGTTGACTTGATTGAAGAATGGATTAAGAGAAATCCAAAAGCTTCCATTTGTACAAATGATGGAATTGAATCTTTCAGGAGAATTGCCAACTTTCAAGATTATCATGGATTGCCTGAATTCACAAATGTAAGTTTTGTTATTTCTCTCCTTTCAAAAACAAAATGTCACATTAAAAATTAGTATACTTTTTTAATTATCCTCCGTTCAATTCTTAAGAAATATCTAATAAATAAAAGGATTATTCTTCTTAATAGGCGTGAAATAAATTAAACTTAGACTTCTTTTAAGATGAATATGAAATACTTACTACTATTATATATGAATTGTAGCGGTGAAAGTCATTATGAATTTGTACAAAAAAAAAGAAAGTTAATGATCAATTTTATTACTATAATTTTACATTCACTTGGAATAAAGAACTAAGATTACATTTAGTTAGTTGAAATAGATATATTTCTTGACTTCTATCTCATACATATATTTCATTTTATCTGACACTATTTTTACTTGTTTATTGAAAATTTAAAAAATTACATACGTTATTAAAATAAATATATTTTTATCCAATTTTTTCGTATAAAAAAATATTTTTTTTTGTGTAGGCGATTGCAAAATTTATGGAGAAAACAAGAGGTGGTAAGGTTAAGTTTGACGCTAAACGTGTAGTAATGGCTGGTGGAGCTACTGGAGCTAATGAGACTCTCATACTTTGTTTGGCTGATCCTGGTGATGCTTTTTTAGTCCCCACACCCTATTACCCAGGGTATGTATACATATTTCTAAATTGAATTCAACTTATATTATATCGATCGTGAAAAAAATAGATGTTTCTTAATTAAATATTAAATTCCTTCTTGCCTATTTAAAATGCGAATTATATTATATCACTCAGTTGACCTTTAAAATCGATATTATATAATATAATTTGTATTTTTCAAATTGAATAAGTGAAAATAGTCATTTAATTTATTTAGTAGATAAGTAAAAATGGACGGACGAAGTATATAAATACCATTTCAGGTAATTGATTGAGGGGAGATTTTTTTTTAATGAAATAACACTTAGTAATTTAAGAGAGACTATCCGTAATGGTCAAATCTTTAGAACTAATATTAATGGGGGCAACTTTTCCTACTTGTGATTTGTCAAAAAAGTTGAAAACTAACAAACAAATGATATTTTTGGTTCTCTGTCTTTTTATTTTGATTAAAAAAAATGAAATTTTCTCATTTTTTTAAAAAAATAATGGATAGTATAAAAATTATAATTACTTTCTTTATCCTGATTTATGTAACATAGTTTGAATTTCTAGACGTTTCAAGTTTAATTCTGAATTTGTATCATATAAAAAGTATTTATTTATTTTAAAATCGTTATGATTAATAATTCAAATGAAAAAATTGATTGACTCTCGAAATTTGTGATTATACAATGATAAAATTATTTAATGGCTTACATTGGCATGTATTTAAGTCTTCATTTGTATTAAATGCAGATTTAATAGGGACCTAAGGTGGAGAAGTGGTGTACAACTTTTACCAATTTCATGCAAGAGTTGCAATAATTTCAAAATTACAATAGAAGCTATCGAAGAGGCCTATGAAAAAGGTCAACAAGCAAATGTCAAAATCAAAGGCTTGATTTTGACCAACCCTTGTAATCCATTAGGTACCATTTTAGATAGGGACACACTTAAAAAAATCTCCACTTTCACTAACGAACATAATATCCATCTTGTTTGCGACGAAATATATGCTGCTACCGTATTCAATCCTCCAAAATTCGTTAGCATCGCTGAAATTATCAACGAAGATAATTGTATCAATAAAGATTTAGTACACATTGTGTCTAGTCTTTCCAAGGACTTAGGTTTTCCAGGATTTCGAGTGGGAATTGTGTACTCGTTCAACGATGATGTTGTTAACTGTGCTAGAAAAATGTCGAGTTTTGGTCTTGTTTCGACTCAGACACAACATTTGCTAGCTTTCATGTTGTCTGACGATGAATTTGTGGAAGAATTTCTTATTGAAAGCGCGAAAAGGTTGAGAGAAAGGTACGAGAAATTCACTAGAGGACTTGAAGAAATAGGAATCAAGTGCTTAGAAAGCAATGCAGGGGTTTATTGTTGGATGGATTTGCGGTCATTGTTGAAAGAAGCAACACTAGATGCTGAGATGTCACTTTGGAAACTCATCATAAACGAAGTTAAGCTCAACGTCTCCCCTGGATCTTCGTTCAATTGCTCGGAGGTAGGATGGTTTCGAGTTTGTTTTGCAAATATCGATGATCAAACAATGGAGATCGCACTTGCAAGGATTCGGATGTTTATGGATGCTTACAACAATGTTAATAAAAATGGAGTCATGAAGAACAAGCACAATGGAAGAGGAACAACCTACGACTTAACTCCTCAAATGGGGAGTACGATGAAAATGTTATTAGCTTAAATATCATGTCTCCTAATTCTCCAATTCCTTGCTCGTAGTGCGAGCAAACAAAATTATTGTTGTACAATCAAATAAAGTTATAAAGCTTGTAAATAAACTAGATTCGCCCAGGCTCGTGCTAAAGCACGGGCCCAACATAGTTAATTTTAGTGTCCTAACACAACCAAATTAATTTTATGTTGATTTTAGTGTCGCCTA
TCTTCCAAACAAAAACTTTTGTACTTCAAATTTCACTAGGCTATTAAACTAAATTCATAAAAATTAGGAAATAATAAAATGGATTTGGAGACGAGTGAGATTTCAAATTACAAGTCATCAGCAGTTTTGTCTAAGTTGGCTAGTAACGAACAACATGGTGAAAACTCACCATATTTTGATGGGTGGAAAGCATACGATAACGACCCTTTCCACTTGGTGAATAATTTGAATGGGGTTATTCAGATGGGTCTCGCGGAAAATCAGCTTTCAGTTGACTTGATTGAAGAATGGATTAAGAGAAATCCAAAAGCTTCCATTTGTACAAATGATGGAATTGAATCTTTCAGGAGAATTGCCAACTTTCAAGATTATCATGGATTGCCTGAATTCACAAATGTAAGTTTTGTTATTTCTCTCCTTTCAAAAACAAAATGTCACATTAAAAATTAGTATACTTTTTTAATTATCCTCCGTTCAATTCTTAAGAAATATCTAATAAATAAAAGGATTATTCTTCTTAATAGGCGTGAAATAAATTAAACTTAGACTTCTTTTAAGATGAATATGAAATACTTACTACTATTATATATGAATTGTAGCGGTGAAAGTCATTATGAATTTGTACAAAAAAAAAGAAAGTTAATGATCAATTTTATTACTATAATTTTACATTCACTTGGAATAAAGAACTAAGATTACATTTAGTTAGTTGAAATAGATATATTTCTTGACTTCTATCTCATACATATATTTCATTTTATCTGACACTATTTTTACTTGTTTATTGAAAATTTAAAAAATTACATACGTTATTAAAATAAATATATTTTTATCCAATTTTTTCGTATAAAAAAATATTTTTTTTTGTGTAGGCGATTGCAAAATTTATGGAGAAAACAAGAGGTGGTAAGGTTAAGTTTGACGCTAAACGTGTAGTAATGGCTGGTGGAGCTACTGGAGCTAATGAGACTCTCATACTTTGTTTGGCTGATCCTGGTGATGCTTTTTTAGTCCCCACACCCTATTACCCAGGGTATGTATACATATTTCTAAATTGAATTCAACTTATATTATATCGATCGTGAAAAAAATAGATGTTTCTTAATTAAATATTAAATTCCTTCTTGCCTATTTAAAATGCGAATTATATTATATCACTCAGTTGACCTTTAAAATCGATATTATATAATATAATTTGTATTTTTCAAATTGAATAAGTGAAAATAGTCATTTAATTTATTTAGTAGATAAGTAAAAATGGACGGACGAAGTATATAAATACCATTTCAGGTAATTGATTGAGGGGAGATTTTTTTTTAATGAAATAACACTTAGTAATTTAAGAGAGACTATCCGTAATGGTCAAATCTTTAGAACTAATATTAATGGGGGCAACTTTTCCTACTTGTGATTTGTCAAAAAAGTTGAAAACTAACAAACAAATGATATTTTTGGTTCTCTGTCTTTTTATTTTGATTAAAAAAAATGAAATTTTCTCATTTTTTTAAAAAAATAATGGATAGTATAAAAATTATAATTACTTTCTTTATCCTGATTTATGTAACATAGTTTGAATTTCTAGACGTTTCAAGTTTAATTCTGAATTTGTATCATATAAAAAGTATTTATTTATTTTAAAATCGTTATGATTAATAATTCAAATGAAAAAATTGATTGACTCTCGAAATTTGTGATTATACAATGATAAAATTATTTAATGGCTTACATTGGCATGTATTTAAGTCTTCATTTGTATTAAATGCAGATTTAATAGGGACCTAAGGTGGAGAAGTGGTGTACAACTTTTACCAATTTCATGCAAGAGTTGCAATAATTTCAAAATTACAATAGAAGCTATCGAAGAGGCCTATGAAAAAGGTCAACAAGCAAATGTCAAAATCAAAGGCTTGATTTTGACCAACCCTTGTAATCCATTAGGTACCATTTTAGATAGGGACACACTTAAAAAAATCTCCACTTTCACTAACGAACATAATATCCATCTTGTTTGCGACGAAATATATGCTGCTACCGTATTCAATCCTCCAAAATTCGTTAGCATCGCTGAAATTATCAACGAAGATAATTGTATCAATAAAGATTTAGTACACATTGTGTCTAGTCTTTCCAAGGACTTAGGTTTTCCAGGATTTCGAGTGGGAATTGTGTACTCGTTCAACGATGATGTTGTTAACTGTGCTAGAAAAATGTCGAGTTTTGGTCTTGTTTCGACTCAGACACAACATTTGCTAGCTTTCATGTTGTCTGACGATGAATTTGTGGAAGAATTTCTTATTGAAAGCGCGAAAAGGTTGAGAGAAAGGTACGAGAAATTCACTAGAGGACTTGAAGAAATAGGAATCAAGTGCTTAGAAAGCAATGCAGGGGTTTATTGTTGGATGGATTTGCGGTCATTGTTGAAAGAAGCAACACTAGATGCTGAGATGTCACTTTGGAAACTCATCATAAACGAAGTTAAGCTCAACGTCTCCCCTGGATCTTCGTTCAATTGCTCGGAGGTAGGATGGTTTCGAGTTTGTTTTGCAAATATCGATGATCAAACAATGGAGATCGCACTTGCAAGGATTCGGATGTTTATGGATGCTTACAACAATGTTAATAAAAATGGAGTCATGAAGAACAAGCACAATGGAAGAGGAACAACCTACGACTTAACTCCTCAAATGGGGAGTACGATGAAAATGTTATTAGCTTAAATATCATGTCTCCTAATTCTCCAATTCCTTGCTCGTAGTGCGAGCAAACAAAATTATTGTTGTACAATCAAATAAAGTTATAAAGCTTGTAAATAAACTAGATTCGCCCAGGCTCGTGCTAAAGCACGGGCCCAACATAGTTAATTTTAGTGTCCTAACACAACCAAATTAATTTTATGTTGATTTTAGTGTCGCCTA
| Download sequence region |
Get flanking sequences on SL2.50ch05
|
mRNA Solyc05g050010.2.1
mRNA Solyc05g050010.2.1
|
Ontology terms
Ontology terms
| terms associated with this mRNA |
cDNA sequence
cDNA sequence
| spliced cDNA sequence, including UTRs |
>Solyc05g050010.2.1 1-aminocyclopropane-1-carboxylate synthase (AHRD V1 **** Q659H5_SOLLC); contains Interpro domain(s) IPR004839 Aminotransferase, class I and II IPR004838 Aminotransferases, class-I, pyridoxal-phosphate-binding site
TCTTCCAAACAAAAACTTTTGTACTTCAAATTTCACTAGGCTATTAAACTAAATTCATAAAAATTAGGAAATAATAAAATGGATTTGGAGACGAGTGAGATTTCAAATTACAAGTCATCAGCAGTTTTGTCTAAGTTGGCTAGTAACGAACAACATGGTGAAAACTCACCATATTTTGATGGGTGGAAAGCATACGATAACGACCCTTTCCACTTGGTGAATAATTTGAATGGGGTTATTCAGATGGGTCTCGCGGAAAATCAGCTTTCAGTTGACTTGATTGAAGAATGGATTAAGAGAAATCCAAAAGCTTCCATTTGTACAAATGATGGAATTGAATCTTTCAGGAGAATTGCCAACTTTCAAGATTATCATGGATTGCCTGAATTCACAAATGCGATTGCAAAATTTATGGAGAAAACAAGAGGTGGTAAGGTTAAGTTTGACGCTAAACGTGTAGTAATGGCTGGTGGAGCTACTGGAGCTAATGAGACTCTCATACTTTGTTTGGCTGATCCTGGTGATGCTTTTTTAGTCCCCACACCCTATTACCCAGGATTTAATAGGGACCTAAGGTGGAGAAGTGGTGTACAACTTTTACCAATTTCATGCAAGAGTTGCAATAATTTCAAAATTACAATAGAAGCTATCGAAGAGGCCTATGAAAAAGGTCAACAAGCAAATGTCAAAATCAAAGGCTTGATTTTGACCAACCCTTGTAATCCATTAGGTACCATTTTAGATAGGGACACACTTAAAAAAATCTCCACTTTCACTAACGAACATAATATCCATCTTGTTTGCGACGAAATATATGCTGCTACCGTATTCAATCCTCCAAAATTCGTTAGCATCGCTGAAATTATCAACGAAGATAATTGTATCAATAAAGATTTAGTACACATTGTGTCTAGTCTTTCCAAGGACTTAGGTTTTCCAGGATTTCGAGTGGGAATTGTGTACTCGTTCAACGATGATGTTGTTAACTGTGCTAGAAAAATGTCGAGTTTTGGTCTTGTTTCGACTCAGACACAACATTTGCTAGCTTTCATGTTGTCTGACGATGAATTTGTGGAAGAATTTCTTATTGAAAGCGCGAAAAGGTTGAGAGAAAGGTACGAGAAATTCACTAGAGGACTTGAAGAAATAGGAATCAAGTGCTTAGAAAGCAATGCAGGGGTTTATTGTTGGATGGATTTGCGGTCATTGTTGAAAGAAGCAACACTAGATGCTGAGATGTCACTTTGGAAACTCATCATAAACGAAGTTAAGCTCAACGTCTCCCCTGGATCTTCGTTCAATTGCTCGGAGGTAGGATGGTTTCGAGTTTGTTTTGCAAATATCGATGATCAAACAATGGAGATCGCACTTGCAAGGATTCGGATGTTTATGGATGCTTACAACAATGTTAATAAAAATGGAGTCATGAAGAACAAGCACAATGGAAGAGGAACAACCTACGACTTAACTCCTCAAATGGGGAGTACGATGAAAATGTTATTAGCTTAAATATCATGTCTCCTAATTCTCCAATTCCTTGCTCGTAGTGCGAGCAAACAAAATTATTGTTGTACAATCAAATAAAGTTATAAAGCTTGTAAATAAACTAGATTCGCCCAGGCTCGTGCTAAAGCACGGGCCCAACATAGTTAATTTTAGTGTCCTAACACAACCAAATTAATTTTATGTTGATTTTAGTGTCGCCTA
TCTTCCAAACAAAAACTTTTGTACTTCAAATTTCACTAGGCTATTAAACTAAATTCATAAAAATTAGGAAATAATAAAATGGATTTGGAGACGAGTGAGATTTCAAATTACAAGTCATCAGCAGTTTTGTCTAAGTTGGCTAGTAACGAACAACATGGTGAAAACTCACCATATTTTGATGGGTGGAAAGCATACGATAACGACCCTTTCCACTTGGTGAATAATTTGAATGGGGTTATTCAGATGGGTCTCGCGGAAAATCAGCTTTCAGTTGACTTGATTGAAGAATGGATTAAGAGAAATCCAAAAGCTTCCATTTGTACAAATGATGGAATTGAATCTTTCAGGAGAATTGCCAACTTTCAAGATTATCATGGATTGCCTGAATTCACAAATGCGATTGCAAAATTTATGGAGAAAACAAGAGGTGGTAAGGTTAAGTTTGACGCTAAACGTGTAGTAATGGCTGGTGGAGCTACTGGAGCTAATGAGACTCTCATACTTTGTTTGGCTGATCCTGGTGATGCTTTTTTAGTCCCCACACCCTATTACCCAGGATTTAATAGGGACCTAAGGTGGAGAAGTGGTGTACAACTTTTACCAATTTCATGCAAGAGTTGCAATAATTTCAAAATTACAATAGAAGCTATCGAAGAGGCCTATGAAAAAGGTCAACAAGCAAATGTCAAAATCAAAGGCTTGATTTTGACCAACCCTTGTAATCCATTAGGTACCATTTTAGATAGGGACACACTTAAAAAAATCTCCACTTTCACTAACGAACATAATATCCATCTTGTTTGCGACGAAATATATGCTGCTACCGTATTCAATCCTCCAAAATTCGTTAGCATCGCTGAAATTATCAACGAAGATAATTGTATCAATAAAGATTTAGTACACATTGTGTCTAGTCTTTCCAAGGACTTAGGTTTTCCAGGATTTCGAGTGGGAATTGTGTACTCGTTCAACGATGATGTTGTTAACTGTGCTAGAAAAATGTCGAGTTTTGGTCTTGTTTCGACTCAGACACAACATTTGCTAGCTTTCATGTTGTCTGACGATGAATTTGTGGAAGAATTTCTTATTGAAAGCGCGAAAAGGTTGAGAGAAAGGTACGAGAAATTCACTAGAGGACTTGAAGAAATAGGAATCAAGTGCTTAGAAAGCAATGCAGGGGTTTATTGTTGGATGGATTTGCGGTCATTGTTGAAAGAAGCAACACTAGATGCTGAGATGTCACTTTGGAAACTCATCATAAACGAAGTTAAGCTCAACGTCTCCCCTGGATCTTCGTTCAATTGCTCGGAGGTAGGATGGTTTCGAGTTTGTTTTGCAAATATCGATGATCAAACAATGGAGATCGCACTTGCAAGGATTCGGATGTTTATGGATGCTTACAACAATGTTAATAAAAATGGAGTCATGAAGAACAAGCACAATGGAAGAGGAACAACCTACGACTTAACTCCTCAAATGGGGAGTACGATGAAAATGTTATTAGCTTAAATATCATGTCTCCTAATTCTCCAATTCCTTGCTCGTAGTGCGAGCAAACAAAATTATTGTTGTACAATCAAATAAAGTTATAAAGCTTGTAAATAAACTAGATTCGCCCAGGCTCGTGCTAAAGCACGGGCCCAACATAGTTAATTTTAGTGTCCTAACACAACCAAATTAATTTTATGTTGATTTTAGTGTCGCCTA
Protein sequence
Protein sequence
| translated polypeptide sequence |
>Solyc05g050010.2.1 1-aminocyclopropane-1-carboxylate synthase (AHRD V1 **** Q659H5_SOLLC); contains Interpro domain(s) IPR004839 Aminotransferase, class I and II IPR004838 Aminotransferases, class-I, pyridoxal-phosphate-binding site
MDLETSEISNYKSSAVLSKLASNEQHGENSPYFDGWKAYDNDPFHLVNNLNGVIQMGLAENQLSVDLIEEWIKRNPKASICTNDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKVKFDAKRVVMAGGATGANETLILCLADPGDAFLVPTPYYPGFNRDLRWRSGVQLLPISCKSCNNFKITIEAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTFTNEHNIHLVCDEIYAATVFNPPKFVSIAEIINEDNCINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDDVVNCARKMSSFGLVSTQTQHLLAFMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIKCLESNAGVYCWMDLRSLLKEATLDAEMSLWKLIINEVKLNVSPGSSFNCSEVGWFRVCFANIDDQTMEIALARIRMFMDAYNNVNKNGVMKNKHNGRGTTYDLTPQMGSTMKMLLA*
MDLETSEISNYKSSAVLSKLASNEQHGENSPYFDGWKAYDNDPFHLVNNLNGVIQMGLAENQLSVDLIEEWIKRNPKASICTNDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKVKFDAKRVVMAGGATGANETLILCLADPGDAFLVPTPYYPGFNRDLRWRSGVQLLPISCKSCNNFKITIEAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTFTNEHNIHLVCDEIYAATVFNPPKFVSIAEIINEDNCINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDDVVNCARKMSSFGLVSTQTQHLLAFMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIKCLESNAGVYCWMDLRSLLKEATLDAEMSLWKLIINEVKLNVSPGSSFNCSEVGWFRVCFANIDDQTMEIALARIRMFMDAYNNVNKNGVMKNKHNGRGTTYDLTPQMGSTMKMLLA*
Gene model matches
Gene model matches
|
SGN Unigenes
SGN Unigenes
| [Associate new unigene] |
Unigene ID:
[loading...]
GenBank accessions
GenBank accessions
| [Associate new genbank sequence] |
M63490 Tomato 1-aminocyclopropane-1-carboxylate synthase mRNA, complete cds.
M38705 Tomato 1-aminocyclopropane-1-carboxylate synthase mRNA, partial cds.
M83329 Lycopersicon esculentum 1-aminocyclopropane-1-carboxylate homologue mRNA, partial cds.
X59146 Lycopersicon esculentum LE-ACC4 mRNA (ptACC4) for 1-aminocyclopropane-1-carboxylic acid synthase.
M38705 Tomato 1-aminocyclopropane-1-carboxylate synthase mRNA, partial cds.
M83329 Lycopersicon esculentum 1-aminocyclopropane-1-carboxylate homologue mRNA, partial cds.
X59146 Lycopersicon esculentum LE-ACC4 mRNA (ptACC4) for 1-aminocyclopropane-1-carboxylic acid synthase.
| Other genome matches | None |
Literature annotations [5]
Literature annotations [5]
| [Associate publication] [Matching publications] |
Differential accumulation of transcripts for four tomato 1-aminocyclopropane-1-carboxylate synthase homologs under various conditions.
Proceedings of the National Academy of Sciences of the United States of America (1992)
Show / hide abstract
Show / hide abstract
Degenerate oligonucleotide primers corresponding to conserved regions flanking the active-site domain of 1-aminocyclopropane-1-carboxylate (ACC) synthase (EC 4.4.1.14) were used for the polymerase chain reaction (PCR) to amplify DNA fragments from mRNA isolated from tomato fruit and tomato suspension cell culture. Antibodies raised against two conserved peptide sequences (TNPSNPLGTT and SLSKDLGLPGFRVG) were used to screen for positive colonies, after the PCR products were cloned into a Bluescript plasmid and expressed in Escherichia coli. Four distinct cDNA fragments encoding ACC synthase homologs were isolated. While pBTAS1 and pBTAS4 were obtained from fruit mRNA, cell culture mRNA yielded three sequences, pBTAS1, pBTAS2, and pBTAS3. Sequencing of these gene fragments revealed that pBTAS1 and pBTAS4 were identical to those full-length sequences previously reported by Van Der Straeten et al. [Van Der Straeten, D., Van Wiemeersch, L., Goodman, H. & Van Montague, M. (1990) Proc. Natl. Acad. Sci. USA 87, 4859-4863] and Olson et al. [Olson, D. C., White, J. A., Edelman, J., Harkin, R. N. & Kende, H. (1991) Proc. Natl. Acad. Sci. USA 88, 5340-5344] from tomato fruit, whereas pBTAS2 and pBTAS3 represent new sequences. Ribonuclease protection assays were used to examine the expression of these transcripts under three different conditions of enhanced ethylene production--namely, during fruit ripening, in response to mechanical wounding in fruit tissue, and auxin stimulation in vegetative tissue. Transcripts of pBTAS1 accumulated massively during ripening and wounding but only slightly in response to auxin treatment. Although pBTAS4 was associated with fruit ripening, it was unresponsive to auxin treatment in vegetative tissue. In contrast, the expression of pBTAS2 and pBTAS3 was greatly promoted in auxin-treated vegetative tissue but was absent from fruit tissue. While the expression of pBTAS2 was moderately dependent on wounding, pBTAS3 was unresponsive to wounding. These data support the view that ACC synthase is encoded by a multigene family and that the members are differentially expressed in response to developmental, environmental, and hormonal factors.
Yip, WK. Moore, T. Yang, SF.
Proceedings of the National Academy of Sciences of the United States of America.
1992.
89(6).
2475-9.
Differential expression of two genes for 1-aminocyclopropane-1-carboxylate synthase in tomato fruits.
Proceedings of the National Academy of Sciences of the United States of America (1991)
Show / hide abstract
Show / hide abstract
1-Aminocyclopropane-1-carboxylate synthase (ACC synthase; S-adenosyl-L-methionine methylthioadenosine-lyase, EC 4.4.1.14) is the regulated enzyme in the biosynthetic pathway of the plant hormone ethylene. A full-length cDNA encoding this enzyme has been cloned from tomato fruits [Van Der Straeten, D., Van Wiemeersch, L., Goodman, H. M. & Van Montagu, M. Proc. Natl. Acad. Sci. USA (1990) 87, 4859-4863]. We report here the complete nucleotide and derived amino acid sequences of a cDNA encoding a second isoform of ACC synthase from tomato fruits. The cDNAs coding for both isoforms contain highly conserved regions that are surrounded by regions of low homology, especially at the 5' and 3' ends. Gene-specific probes were constructed to examine the expression of transcripts encoding the two ACC synthase isoforms under two conditions of enhanced ethylene formation--namely, during fruit ripening and in response to mechanical stress (wounding). The level of mRNA encoding both isoforms, ACC synthase 1 and 2, increased during ripening. In contrast, wounding caused an increase in only the level of mRNA coding for ACC synthase 1. Blot analysis of genomic DNA digested with restriction enzymes confirmed that ACC synthase 1 and 2 are encoded by different genes.
Olson, DC. White, JA. Edelman, L. Harkins, RN. Kende, H.
Proceedings of the National Academy of Sciences of the United States of America.
1991.
88(12).
5340-4.
1-aminocyclopropane-1-carboxylate synthase in tomato is encoded by a multigene family whose transcription is induced during fruit and floral senescence.
Journal of molecular biology (1991)
Show / hide abstract
Show / hide abstract
The key regulatory enzyme in the biosynthetic pathway of the plant hormone ethylene is 1-aminocyclopropane-1-carboxylic acid (ACC) synthase (EC 4.1.1.14). It catalyzes the conversion of S-adenosylmethionine to ACC, the precursor of ethylene. We isolated complementary DNA sequences, ptACC2 and ptACC4, for two distinct and differentially regulated ACC synthase mRNAs expressed in ripe tomato fruit. The authenticity of the clones has been confirmed by expression experiments in E. coli. The predicted size of the encoded polypeptides (54,690 and 53,519 Da) is similar to that of the primary in vitro translation products and to the proteins found in vivo. The sequence of the gene encoding one mRNA, LE-ACC2, has been determined and its transcription initiation site defined. Four additional genes, LE-ACC1A, LE-ACC1B, LE-ACC3 and LE-ACC4, have also been identified and the sequence of their coding regions determined. The LE-ACC1A and LE-ACC1B genes are adjacent to each other and are convergently transcribed. Their encoded polypeptides are 96% identical; the identity of the other polypeptides to each other varies between 50 and 70%. The proteins predicted to be encoded by the ACC synthase genes so far cloned from tomato and zucchini contain 11 of the 12 conserved amino acid residues found in various aminotransferases involved in the binding of the substrate and the cofactor pyridoxal-5'-phosphate. The data indicate that ACC synthase is encoded by a divergent multigene family in tomato that encodes proteins related to aminotransferases.
Rottmann, WH. Peter, GF. Oeller, PW. Keller, JA. Shen, NF. Nagy, BP. Taylor, LP. Campbell, AD. Theologis, A.
Journal of molecular biology.
1991.
222(4).
937-61.
Cloning and sequence of two different cDNAs encoding 1-aminocyclopropane-1-carboxylate synthase in tomato.
Proceedings of the National Academy of Sciences of the United States of America (1990)
Show / hide abstract
Show / hide abstract
1-Aminocyclopropane-1-carboxylate synthase (ACC synthase; S-adenosyl-L-methionine methylthioadenosine-lyase, EC 4.4.1.14), the key enzyme in ethylene biosynthesis, was purified 5000-fold from induced tomato pericarp. ACC synthase activity was unambiguously correlated with a 45-kDa protein by two independent methods. Peptide sequences were obtained both from the N terminus after electroblotting and from tryptic peptides separated by reversed-phase chromatography. Mixed oligonucleotide probes were used to screen a lambda gt11 library prepared from RNA of induced pericarp tissue. Putative ACC synthase clones were isolated with a frequency of 0.01%. One of these contained a 1.9-kilobase insert with a single open reading frame encoding a polypeptide of 55 kDa. A second, partial cDNA clone was found that differed from the first one in 18% of its bases. Genomic Southern blotting suggests possible tandem organization of the two genes in tomato. The entire coding region was expressed in Escherichia coli and the denatured recombinant polypeptide was used to raise polyclonal antibodies. The antibody preparation both immunoinhibits and immunoprecipitates ACC synthase activity from an enriched tomato extract, confirming the identity of the clone. Northern blot analysis demonstrates that the ACC synthase messenger accumulation is coordinated with fruit ripening.
Van der Straeten, D. Van Wiemeersch, L. Goodman, HM. Van Montagu, M.
Proceedings of the National Academy of Sciences of the United States of America.
1990.
87(12).
4859-63.
Transcriptional regulation of the ethylene response factor LeERF2 in the expression of ethylene biosynthesis genes controls ethylene production in tomato and tobacco.
Plant physiology (2009)
Show / hide abstract
Show / hide abstract
Fine-tuning of ethylene production plays an important role in developmental processes and in plant responses to stress, but very little is known about the regulation of ethylene response factor (ERF) proteins in ethylene biosynthesis genes and ethylene production. Identifying cis-acting elements and transcription factors that play a role in this process, therefore, is important. Previously, a tomato (Solanum lycopersicum [f. sp. Lycopersicon esculentum]) ERF protein, LeERF2, an allele of TERF2, was reported to confer ethylene triple response on plants. This paper reports the transcriptional modulation of LeERF2/TERF2 in ethylene biosynthesis in tomato and tobacco (Nicotiana tabacum). Using overexpressing and antisense LeERF2/TERF2 transgenic tomato, we found that LeERF2/TERF2 is an important regulator in the expression of ethylene biosynthesis genes and the production of ethylene. Expression analysis revealed that LeERF2/TERF2 is ethylene inducible, and ethylene production stimulated by ethylene was suppressed in antisense LeERF2/TERF2 transgenic tomato, indicating LeERF2/TERF2 to be a positive regulator in the feedback loop of ethylene induction. Further research showed that LeERF2/TERF2 conservatively modulates ethylene biosynthesis in tobacco and that such regulation in tobacco is associated with the elongation of the hypocotyl and insensitivity to abscisic acid and glucose during germination and seedling development. The effects on ethylene synthesis were similar to those of another ERF protein, TERF1, because TERF1 and LeERF2/TERF2 have overlapping roles in the transcriptional regulation of ethylene biosynthesis in tobacco. Biochemical analysis showed that LeERF2/TERF2 interacted with GCC box in the promoter of NtACS3 and with dehydration-responsive element in the promoter of LeACO3, resulting in transcriptional activation of the genes for ethylene biosynthesis in tomato and tobacco, which is a novel regulatory function of ERF proteins in plant ethylene biosynthesis.
Zhang, Z. Zhang, H. Quan, R. Wang, XC. Huang, R.
Plant physiology.
2009.
150(1).
365-77.
Ontology annotations (4)
Ontology annotations (4)
| [Add ontology annotations] |
[loading...]
Related views
Related views
|
- Genomic details
| User comments |
Please wait, checking for comments. (If comments do not show up, access them here)
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working

Links to external databases
Links to external databases
