This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
Tomato locus auxin-regulated IAA2
| Locus details | Download GMOD XML | Note to Editors | Annotation guidelines |
[loading edit links...]
|
[loading...]
|
|
Links to external databases
Links to external databases
|
auxin-regulated IAA2 is on PhyloGenes
TomDelDB genotype frequencies in tomato populations. chromosome SL2.50ch06, position: 49327285
Please cite Razifard et al.
| Registry name: | None | [Associate registry name] |
Notes and figures (0)
Notes and figures (0)
| [Add notes, figures or images] |
Success
The display image was set successfully.
| Image | Description | Type |
|---|
Accessions and images (1)
Accessions and images (1)
| [Associate accession] |
| Alleles (0) | None | [Add new Allele] |
Associated loci (97)
Associated loci (97)
| [Associate new locus] |
[loading...]
|
Associated loci - graphical view
Associated loci - graphical view
| View auxin-regulated IAA2 relationships in the stand-alone network browser |
[loading...] | [Legend] [Levels] |
SolCyc links
SolCyc links
|
[loading...]
Sequence annotations
Sequence annotations
|
Genome features
Genome features
|
Genomic sequence
Genomic sequence
| unprocessed genomic sequence region underlying this gene |
>Solyc06g084070.2 SL2.50ch06:49326812..49327639
ATGGAAATGGCTGGAACAGAGCTAAGATTAGGTTTACCTGGAACAGTTCCATCATCCACAAGTAAAATTAGCAACAAAAGATGTTCATCACATAGGAATAACAATGATGAACCACCACAAAAGTAAGTATACTTGTTAATCTATATATCTTTTTTTTTTTGTTGCTAATTATACTAACAACTGAATTATTTCAGAGCACAAGTAGTTGGATGGCCACCGGTTCGATCCTATCGAAAGAACATTTTAGAAGCGAGCTATGTTAAAGTGAGCATGGATGGTGCGGCTTATTTAAGGAAAATTGATCTTAATACTTACAAAAGTTATCCACAATTACTCAAGGCTTTAGAGAACATGTTCAAGTGCTCTATTGGTAAGTTTTAACATAACTATTAGTGGTCAATTCTTTTAATCAGAGTCTTATGATTTTTTATATATATAAAATTCAGATGTATATTCAGAAACAGATGGATACAACGGATGTAATTATATACCAACTTACGAAGATAAAGATGGTGATTGGATGCTTGCTGGTGACGTACCTTGGGATATGTTCATTAATTCTTGCAAAAGGCTAAGAATTATGAAAGGATCTGAAGCTAAAGGTTTAGCAAGCTTATAGATCTGATCGATTCAGTTTTGAAATGTATATCTAACTCTATTTATTTGAGCCGGTACAGTTTATCCTAACCGAAAGTAAAGTTTGATCAACTTTTCTTGTACATAATAAAGTTTTTATTTATTTTCATTTGAAGAATTTATTGTGTATTTTCAAAAAGGATATATATATATATACGAACATAAATATATACTCAATTCTCAATTATTGTG
ATGGAAATGGCTGGAACAGAGCTAAGATTAGGTTTACCTGGAACAGTTCCATCATCCACAAGTAAAATTAGCAACAAAAGATGTTCATCACATAGGAATAACAATGATGAACCACCACAAAAGTAAGTATACTTGTTAATCTATATATCTTTTTTTTTTTGTTGCTAATTATACTAACAACTGAATTATTTCAGAGCACAAGTAGTTGGATGGCCACCGGTTCGATCCTATCGAAAGAACATTTTAGAAGCGAGCTATGTTAAAGTGAGCATGGATGGTGCGGCTTATTTAAGGAAAATTGATCTTAATACTTACAAAAGTTATCCACAATTACTCAAGGCTTTAGAGAACATGTTCAAGTGCTCTATTGGTAAGTTTTAACATAACTATTAGTGGTCAATTCTTTTAATCAGAGTCTTATGATTTTTTATATATATAAAATTCAGATGTATATTCAGAAACAGATGGATACAACGGATGTAATTATATACCAACTTACGAAGATAAAGATGGTGATTGGATGCTTGCTGGTGACGTACCTTGGGATATGTTCATTAATTCTTGCAAAAGGCTAAGAATTATGAAAGGATCTGAAGCTAAAGGTTTAGCAAGCTTATAGATCTGATCGATTCAGTTTTGAAATGTATATCTAACTCTATTTATTTGAGCCGGTACAGTTTATCCTAACCGAAAGTAAAGTTTGATCAACTTTTCTTGTACATAATAAAGTTTTTATTTATTTTCATTTGAAGAATTTATTGTGTATTTTCAAAAAGGATATATATATATATACGAACATAAATATATACTCAATTCTCAATTATTGTG
| Download sequence region |
Get flanking sequences on SL2.50ch06
|
mRNA Solyc06g084070.2.1
mRNA Solyc06g084070.2.1
|
Ontology terms
Ontology terms
| terms associated with this mRNA |
cDNA sequence
cDNA sequence
| spliced cDNA sequence, including UTRs |
>Solyc06g084070.2.1 Auxin responsive protein (AHRD V1 ***- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein
ATGGAAATGGCTGGAACAGAGCTAAGATTAGGTTTACCTGGAACAGTTCCATCATCCACAAGTAAAATTAGCAACAAAAGATGTTCATCACATAGGAATAACAATGATGAACCACCACAAAAAGCACAAGTAGTTGGATGGCCACCGGTTCGATCCTATCGAAAGAACATTTTAGAAGCGAGCTATGTTAAAGTGAGCATGGATGGTGCGGCTTATTTAAGGAAAATTGATCTTAATACTTACAAAAGTTATCCACAATTACTCAAGGCTTTAGAGAACATGTTCAAGTGCTCTATTGATGTATATTCAGAAACAGATGGATACAACGGATGTAATTATATACCAACTTACGAAGATAAAGATGGTGATTGGATGCTTGCTGGTGACGTACCTTGGGATATGTTCATTAATTCTTGCAAAAGGCTAAGAATTATGAAAGGATCTGAAGCTAAAGGTTTAGCAAGCTTATAGATCTGATCGATTCAGTTTTGAAATGTATATCTAACTCTATTTATTTGAGCCGGTACAGTTTATCCTAACCGAAAGTAAAGTTTGATCAACTTTTCTTGTACATAATAAAGTTTTTATTTATTTTCATTTGAAGAATTTATTGTGTATTTTCAAAAAGGATATATATATATATACGAACATAAATATATACTCAATTCTCAATTATTGTG
ATGGAAATGGCTGGAACAGAGCTAAGATTAGGTTTACCTGGAACAGTTCCATCATCCACAAGTAAAATTAGCAACAAAAGATGTTCATCACATAGGAATAACAATGATGAACCACCACAAAAAGCACAAGTAGTTGGATGGCCACCGGTTCGATCCTATCGAAAGAACATTTTAGAAGCGAGCTATGTTAAAGTGAGCATGGATGGTGCGGCTTATTTAAGGAAAATTGATCTTAATACTTACAAAAGTTATCCACAATTACTCAAGGCTTTAGAGAACATGTTCAAGTGCTCTATTGATGTATATTCAGAAACAGATGGATACAACGGATGTAATTATATACCAACTTACGAAGATAAAGATGGTGATTGGATGCTTGCTGGTGACGTACCTTGGGATATGTTCATTAATTCTTGCAAAAGGCTAAGAATTATGAAAGGATCTGAAGCTAAAGGTTTAGCAAGCTTATAGATCTGATCGATTCAGTTTTGAAATGTATATCTAACTCTATTTATTTGAGCCGGTACAGTTTATCCTAACCGAAAGTAAAGTTTGATCAACTTTTCTTGTACATAATAAAGTTTTTATTTATTTTCATTTGAAGAATTTATTGTGTATTTTCAAAAAGGATATATATATATATACGAACATAAATATATACTCAATTCTCAATTATTGTG
Protein sequence
Protein sequence
| translated polypeptide sequence |
>Solyc06g084070.2.1 Auxin responsive protein (AHRD V1 ***- D9IQE6_CATRO); contains Interpro domain(s) IPR003311 AUX/IAA protein
MEMAGTELRLGLPGTVPSSTSKISNKRCSSHRNNNDEPPQKAQVVGWPPVRSYRKNILEASYVKVSMDGAAYLRKIDLNTYKSYPQLLKALENMFKCSIDVYSETDGYNGCNYIPTYEDKDGDWMLAGDVPWDMFINSCKRLRIMKGSEAKGLASL*
MEMAGTELRLGLPGTVPSSTSKISNKRCSSHRNNNDEPPQKAQVVGWPPVRSYRKNILEASYVKVSMDGAAYLRKIDLNTYKSYPQLLKALENMFKCSIDVYSETDGYNGCNYIPTYEDKDGDWMLAGDVPWDMFINSCKRLRIMKGSEAKGLASL*
Gene model matches
Gene model matches
|
SGN Unigenes
SGN Unigenes
| [Associate new unigene] |
Unigene ID:
[loading...]
GenBank accessions
GenBank accessions
| [Associate new genbank sequence] |
AF022013 Lycopersicon esculentum auxin-regulated IAA2 (IAA2) mRNA, partial cds.
JN379432 Solanum lycopersicum IAA2 mRNA, complete cds.
NM_001279113 Solanum lycopersicum IAA2 (LOC101055542), mRNA
JN379432 Solanum lycopersicum IAA2 mRNA, complete cds.
NM_001279113 Solanum lycopersicum IAA2 (LOC101055542), mRNA
| Other genome matches | None |
Literature annotations [4]
Literature annotations [4]
| [Associate publication] [Matching publications] |
The diageotropica mutation alters auxin induction of a subset of the Aux/IAA gene family in tomato.
Plant molecular biology (2000)
Show / hide abstract
Show / hide abstract
The diageotropica (dgt) mutation has been proposed to affect either auxin perception or responsiveness in tomato plants. It has previously been demonstrated that the expression of one member of the Aux/IAA family of auxin-regulated genes is reduced in dgt plants. Here, we report the cloning of ten new members of the tomato Aux/IAA family by PCR amplification based on conserved protein domains. All of the gene family members except one (LelAA7) are expressed in etiolated tomato seedlings, although they demonstrate tissue specificity (e.g. increased expression in hypocotyls vs. roots) within the seedling. The wild-type auxin-response characteristics of the expression of these tomato LelAA genes are similar to those previously described for Aux/IAA family members in Arabidopsis. In dgt seedlings, auxin stimulation of gene expression was reduced in only a subset of LelAA genes (LelAA5, 8, 10, and 11), with the greatest reduction associated with those genes with the strongest wild-type response to auxin. The remaining LelAA genes tested exhibited essentially the same induction levels in response to the hormone in both dgt and wild-type hypocotyls. These results confirm that dgt plants can perceive auxin and suggest that a specific step in early auxin signal transduction is disrupted by the dgt mutation.
Nebenführ, A. White, TJ. Lomax, TL.
Plant molecular biology.
2000.
44(1).
73-84.
Genome-wide analysis of Aux/IAA gene family in Solanaceae species using tomato as a model.
Molecular genetics and genomics : MGG (2012)
Show / hide abstract
Show / hide abstract
Auxin plays key roles in a wide variety of plant activities, including embryo development, leaf formation, phototropism, fruit development and root initiation and development. Auxin/indoleacetic acid (Aux/IAA) genes, encoding short-lived nuclear proteins, are key regulators in the auxin transduction pathway. But how they work is still unknown. In order to conduct a systematic analysis of this gene family in Solanaceae species, a genome-wide search for the homologues of auxin response genes was carried out. Here, 26 and 27 non redundant AUX/IAAs were identified in tomato and potato, respectively. Using tomato as a model, a comprehensive overview of SlIAA gene family is presented, including the gene structures, phylogeny, chromosome locations, conserved motifs and cis-elements in promoter sequences. A phylogenetic tree generated from alignments of the predicted protein sequences of 31 OsIAAs, 29 AtIAAs, 31 ZmIAAs, and 26 SlIAAs revealed that these IAAs were clustered into three major groups and ten subgroups. Among them, seven subgroups were present in both monocot and dicot species, which indicated that the major functional diversification within the IAA family predated the monocot/dicot divergence. In contrast, group C and some other subgroups seemed to be species-specific. Quantitative real-time PCR (qRT-PCR) analysis showed that 19 of the 26 SlIAA genes could be detected in all tomato organs/tissues, however, seven of them were specifically expressed in some of tomato tissues. The transcript abundance of 17 SlIAA genes were increased within a few hours when the seedlings were treated with exogenous IAA. However, those of other six SlIAAs were decreased. The results of stress treatments showed that most SIIAA family genes responded to at least one of the three stress treatments, however, they exhibited diverse expression levels under different abiotic stress conditions in tomato seedlings. SlIAA20, SlIAA21 and SlIAA22 were not significantly influenced by stress treatments even though at least one stress-related cis-element was identified in their promoter regions. In conclusion, our comparative analysis provides an insight into the evolution and expression patterns in various tissues and in response to auxin or stresses of the Aux/IAA family members in tomato, which will provide a very useful reference for cloning and functional analysis of each member of AUX/IAA gene family in Solanaceae crops.
Wu, J. Peng, Z. Liu, S. He, Y. Cheng, L. Kong, F. Wang, J. Lu, G.
Molecular genetics and genomics : MGG.
2012.
().
.
Genome-wide identification, functional analysis and expression profiling of the Aux/IAA gene family in tomato.
Plant & cell physiology (2012)
Show / hide abstract
Show / hide abstract
Auxin is a central hormone that exerts pleiotropic effects on plant growth including the development of roots, shoots, flowers and fruit. The perception and signaling of the plant hormone auxin rely on the cooperative action of several components, among which auxin/indole-3-acetic acid (Aux/IAA) proteins play a pivotal role. In this study, we identified and comprehensively analyzed the entire Aux/IAA gene family in tomato (Solanum lycopersicum), a reference species for Solanaceae plants, and the model plant for fleshy fruit development. Functional characterization using a dedicated single cell system revealed that tomato Aux/IAA proteins function as active repressors of auxin-dependent gene transcription, with, however, different Aux/IAA members displaying varying levels of repression. Phylogenetic analysis indicated that the Aux/IAA gene family is slightly contracted in tomato compared with Arabidopsis, with a lower representation of non-canonical proteins. Sl-IAA genes display distinctive expression pattern in different tomato organs and tissues, and some of them display differential responses to auxin and ethylene, suggesting that Aux/IAAs may play a role in linking both hormone signaling pathways. The data presented here shed more light on Sl-IAA genes and provides new leads towards the elucidation of their function during plant development and in mediating hormone cross-talk.
Audran-Delalande, C. Bassa, C. Mila, I. Regad, F. Zouine, M. Bouzayen, M.
Plant & cell physiology.
2012.
53(4).
659-72.
Transcriptome profiling of cytokinin and auxin regulation in tomato root.
Journal of experimental botany (2013)
Show / hide abstract
Show / hide abstract
Tomato is a model and economically important crop plant with little information available about gene expression in roots. Currently, there have only been a few studies that examine hormonal responses in tomato roots and none at a genome-wide level. This study examined the transcriptome atlas of tomato root regions (root tip, lateral roots, and whole roots) and the transcriptional regulation of each root region in response to the plant hormones cytokinin and auxin using Illumina RNA sequencing. More than 165 million 1×54 base pair reads were mapped onto the Solanum lycopersicum reference genome and differential expression patterns in each root region in response to each hormone were assessed. Many novel cytokinin- and auxin-induced and -repressed genes were identified as significantly differentially expressed and the expression levels of several were confirmed by qPCR. A number of these regulated genes represent tomato orthologues of cytokinin- or auxin-regulated genes identified in other species, including CKXs, type-A RRs, Aux/IAAs, and ARFs. Additionally, the data confirm some of the hormone regulation studies for recently examined genes in tomato such as SlIAAs and SlGH3s. Moreover, genes expressed abundantly in each root region were identified which provide a spatial distribution of many classes of genes, including plant defence, secondary metabolite production, and general metabolism across the root. Overall this study presents the first global expression patterns of hormone-regulated transcripts in tomato roots, which will be functionally relevant for future studies directed towards tomato root growth and development.
Gupta, S. Shi, X. Lindquist, IE. Devitt, N. Mudge, J. Rashotte, AM.
Journal of experimental botany.
2013.
64(2).
695-704.
Ontology annotations (4)
Ontology annotations (4)
| [Add ontology annotations] |
[loading...]
Related views
Related views
|
| User comments |
Please wait, checking for comments. (If comments do not show up, access them here)
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
List Comparison
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working

Links to external databases
Links to external databases
