This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
Tomato locus C-repeat binding factor 1
| Locus details | Download GMOD XML | Note to Editors | Annotation guidelines |
[loading edit links...]
|
[loading...]
|
|
Links to external databases
Links to external databases
|
TomDelDB genotype frequencies in tomato populations. chromosome SL2.50ch03, position: 3715092
Please cite Razifard et al.
TomDelDB genotype frequencies in tomato populations. chromosome SL2.50ch03, position: 3715128
Please cite Razifard et al.
| Registry name: | None | [Associate registry name] |
Notes and figures (0)
Notes and figures (0)
| [Add notes, figures or images] |
Success
The display image was set successfully.
| Image | Description | Type |
|---|
Accessions and images (3)
Accessions and images (3)
| [Associate accession] |
Alleles (1)
Alleles (1)
| [Add new Allele] |
Associated loci (1)
Associated loci (1)
| [Associate new locus] |
[loading...]
|
Associated loci - graphical view
Associated loci - graphical view
| View C-repeat binding factor 1 relationships in the stand-alone network browser |
[loading...] | [Legend] [Levels] |
SolCyc links
SolCyc links
|
[loading...]
Sequence annotations
Sequence annotations
|
Genome features
Genome features
|
Genomic sequence
Genomic sequence
| unprocessed genomic sequence region underlying this gene |
>Solyc03g026280.2 SL2.50ch03:3714682..3715578
TCTTTAACTCAACAATTATACAAATACTTTCTATTTTTAGCTCTCAACAACAATGAATATCTTTGAAACCTATTATTCAGACTCGTTAATTTTAACCGAATCATCTTCTTCTTCATCGTCATCGTCGTTTTCTGAAGAGGAAGTTATTTTAGCTTCGAATAACCCGAAAAAGCCAGCTGGCAGGAAGAAGTTTCGAGAAACACGGCATCCGATATACAGGGGAATCAGGAAGAGGAATTCAGGAAAATGGGTTTGTGAAGTCAGAGAACCAAATAAGAAGACAAGGATTTGGCTTGGTACTTTTCCTACGGCTGAAATGGCGGCTAGAGCTCATGACGTGGCGGCTTTAGCATTAAGAGGCCGTTCTGCTTGTTTGAATTTCTCTGATTCTGCTTGGAGGCTGCCTATCCCTGCTTCCTCCAACTCTAAAGATATTCAAAAGGCGGCCGCTCAGGCCGTCGAAATCTTCCGATCGGAAGAAGTTTCAGGAGAATCTCCTGAAACGTCAGAAAATGTGCAAGAGAGTAGTGACTTCGTGGATGAGGAGGCGATCTTTTTCATGCCAGGATTACTTGCAAATATGGCAGAAGGACTTATGCTACCTCCACCTCAATGTGCAGAAATGGGAGATCATTGTGTGGAAACTGATGCCTACATGATAACTTTATGGAATTATTCTATCTAAAATAGTAGTACAATTTATCAAATTACTAGGATTTAGAAGATTTTGTTAGTTTTTGGTATTCAGTATTTAGATACTAAGAATGTATATTATTAGTATTTTTATTTTGGCCAAATACATGAACATGAACAGAAACTTGTTGGGTTTTTTTACTCAGGTACCTCAACTACATCATTTTTCTATTGATTATTGAACTACACATAATTTGTTTCTTT
TCTTTAACTCAACAATTATACAAATACTTTCTATTTTTAGCTCTCAACAACAATGAATATCTTTGAAACCTATTATTCAGACTCGTTAATTTTAACCGAATCATCTTCTTCTTCATCGTCATCGTCGTTTTCTGAAGAGGAAGTTATTTTAGCTTCGAATAACCCGAAAAAGCCAGCTGGCAGGAAGAAGTTTCGAGAAACACGGCATCCGATATACAGGGGAATCAGGAAGAGGAATTCAGGAAAATGGGTTTGTGAAGTCAGAGAACCAAATAAGAAGACAAGGATTTGGCTTGGTACTTTTCCTACGGCTGAAATGGCGGCTAGAGCTCATGACGTGGCGGCTTTAGCATTAAGAGGCCGTTCTGCTTGTTTGAATTTCTCTGATTCTGCTTGGAGGCTGCCTATCCCTGCTTCCTCCAACTCTAAAGATATTCAAAAGGCGGCCGCTCAGGCCGTCGAAATCTTCCGATCGGAAGAAGTTTCAGGAGAATCTCCTGAAACGTCAGAAAATGTGCAAGAGAGTAGTGACTTCGTGGATGAGGAGGCGATCTTTTTCATGCCAGGATTACTTGCAAATATGGCAGAAGGACTTATGCTACCTCCACCTCAATGTGCAGAAATGGGAGATCATTGTGTGGAAACTGATGCCTACATGATAACTTTATGGAATTATTCTATCTAAAATAGTAGTACAATTTATCAAATTACTAGGATTTAGAAGATTTTGTTAGTTTTTGGTATTCAGTATTTAGATACTAAGAATGTATATTATTAGTATTTTTATTTTGGCCAAATACATGAACATGAACAGAAACTTGTTGGGTTTTTTTACTCAGGTACCTCAACTACATCATTTTTCTATTGATTATTGAACTACACATAATTTGTTTCTTT
| Download sequence region |
Get flanking sequences on SL2.50ch03
|
mRNA Solyc03g026280.2.1
mRNA Solyc03g026280.2.1
|
Ontology terms
Ontology terms
| terms associated with this mRNA |
cDNA sequence
cDNA sequence
| spliced cDNA sequence, including UTRs |
>Solyc03g026280.2.1 CRT binding factor 2 (AHRD V1 *-*- B3TPN7_SOLHA); contains Interpro domain(s) IPR001471 Pathogenesis-related transcriptional factor and ERF, DNA-binding
TCTTTAACTCAACAATTATACAAATACTTTCTATTTTTAGCTCTCAACAACAATGAATATCTTTGAAACCTATTATTCAGACTCGTTAATTTTAACCGAATCATCTTCTTCTTCATCGTCATCGTCGTTTTCTGAAGAGGAAGTTATTTTAGCTTCGAATAACCCGAAAAAGCCAGCTGGCAGGAAGAAGTTTCGAGAAACACGGCATCCGATATACAGGGGAATCAGGAAGAGGAATTCAGGAAAATGGGTTTGTGAAGTCAGAGAACCAAATAAGAAGACAAGGATTTGGCTTGGTACTTTTCCTACGGCTGAAATGGCGGCTAGAGCTCATGACGTGGCGGCTTTAGCATTAAGAGGCCGTTCTGCTTGTTTGAATTTCTCTGATTCTGCTTGGAGGCTGCCTATCCCTGCTTCCTCCAACTCTAAAGATATTCAAAAGGCGGCCGCTCAGGCCGTCGAAATCTTCCGATCGGAAGAAGTTTCAGGAGAATCTCCTGAAACGTCAGAAAATGTGCAAGAGAGTAGTGACTTCGTGGATGAGGAGGCGATCTTTTTCATGCCAGGATTACTTGCAAATATGGCAGAAGGACTTATGCTACCTCCACCTCAATGTGCAGAAATGGGAGATCATTGTGTGGAAACTGATGCCTACATGATAACTTTATGGAATTATTCTATCTAAAATAGTAGTACAATTTATCAAATTACTAGGATTTAGAAGATTTTGTTAGTTTTTGGTATTCAGTATTTAGATACTAAGAATGTATATTATTAGTATTTTTATTTTGGCCAAATACATGAACATGAACAGAAACTTGTTGGGTTTTTTTACTCAGGTACCTCAACTACATCATTTTTCTATTGATTATTGAACTACACATAATTTGTTTCTTT
TCTTTAACTCAACAATTATACAAATACTTTCTATTTTTAGCTCTCAACAACAATGAATATCTTTGAAACCTATTATTCAGACTCGTTAATTTTAACCGAATCATCTTCTTCTTCATCGTCATCGTCGTTTTCTGAAGAGGAAGTTATTTTAGCTTCGAATAACCCGAAAAAGCCAGCTGGCAGGAAGAAGTTTCGAGAAACACGGCATCCGATATACAGGGGAATCAGGAAGAGGAATTCAGGAAAATGGGTTTGTGAAGTCAGAGAACCAAATAAGAAGACAAGGATTTGGCTTGGTACTTTTCCTACGGCTGAAATGGCGGCTAGAGCTCATGACGTGGCGGCTTTAGCATTAAGAGGCCGTTCTGCTTGTTTGAATTTCTCTGATTCTGCTTGGAGGCTGCCTATCCCTGCTTCCTCCAACTCTAAAGATATTCAAAAGGCGGCCGCTCAGGCCGTCGAAATCTTCCGATCGGAAGAAGTTTCAGGAGAATCTCCTGAAACGTCAGAAAATGTGCAAGAGAGTAGTGACTTCGTGGATGAGGAGGCGATCTTTTTCATGCCAGGATTACTTGCAAATATGGCAGAAGGACTTATGCTACCTCCACCTCAATGTGCAGAAATGGGAGATCATTGTGTGGAAACTGATGCCTACATGATAACTTTATGGAATTATTCTATCTAAAATAGTAGTACAATTTATCAAATTACTAGGATTTAGAAGATTTTGTTAGTTTTTGGTATTCAGTATTTAGATACTAAGAATGTATATTATTAGTATTTTTATTTTGGCCAAATACATGAACATGAACAGAAACTTGTTGGGTTTTTTTACTCAGGTACCTCAACTACATCATTTTTCTATTGATTATTGAACTACACATAATTTGTTTCTTT
Protein sequence
Protein sequence
| translated polypeptide sequence |
>Solyc03g026280.2.1 CRT binding factor 2 (AHRD V1 *-*- B3TPN7_SOLHA); contains Interpro domain(s) IPR001471 Pathogenesis-related transcriptional factor and ERF, DNA-binding
MNIFETYYSDSLILTESSSSSSSSSFSEEEVILASNNPKKPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAALALRGRSACLNFSDSAWRLPIPASSNSKDIQKAAAQAVEIFRSEEVSGESPETSENVQESSDFVDEEAIFFMPGLLANMAEGLMLPPPQCAEMGDHCVETDAYMITLWNYSI*
MNIFETYYSDSLILTESSSSSSSSSFSEEEVILASNNPKKPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAALALRGRSACLNFSDSAWRLPIPASSNSKDIQKAAAQAVEIFRSEEVSGESPETSENVQESSDFVDEEAIFFMPGLLANMAEGLMLPPPQCAEMGDHCVETDAYMITLWNYSI*
Gene model matches
Gene model matches
|
SGN Unigenes
SGN Unigenes
| [Associate new unigene] |
Unigene ID:
[loading...]
GenBank accessions
GenBank accessions
| [Associate new genbank sequence] |
| Other genome matches | None |
Literature annotations [4]
Literature annotations [4]
| [Associate publication] [Matching publications] |
Components of the Arabidopsis C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napus and other plant species.
Plant physiology (2001)
Show / hide abstract
Show / hide abstract
Many plants increase in freezing tolerance in response to low, nonfreezing temperatures, a phenomenon known as cold acclimation. Cold acclimation in Arabidopsis involves rapid cold-induced expression of the C-repeat/dehydration-responsive element binding factor (CBF) transcriptional activators followed by expression of CBF-targeted genes that increase freezing tolerance. Here, we present evidence for a CBF cold-response pathway in Brassica napus. We show that B. napus encodes CBF-like genes and that transcripts for these genes accumulate rapidly in response to low temperature followed closely by expression of the cold-regulated Bn115 gene, an ortholog of the Arabidopsis CBF-targeted COR15a gene. Moreover, we show that constitutive overexpression of the Arabidopsis CBF genes in transgenic B. napus plants induces expression of orthologs of Arabidopsis CBF-targeted genes and increases the freezing tolerance of both nonacclimated and cold-acclimated plants. Transcripts encoding CBF-like proteins were also found to accumulate rapidly in response to low temperature in wheat (Triticum aestivum L. cv Norstar) and rye (Secale cereale L. cv Puma), which cold acclimate, as well as in tomato (Lycopersicon esculentum var. Bonny Best, Castle Mart, Micro-Tom, and D Huang), a freezing-sensitive plant that does not cold acclimate. An alignment of the CBF proteins from Arabidopsis, B. napus, wheat, rye, and tomato revealed the presence of conserved amino acid sequences, PKK/RPAGRxKFxETRHP and DSAWR, that bracket the AP2/EREBP DNA binding domains of the proteins and distinguish them from other members of the AP2/EREBP protein family. We conclude that components of the CBF cold-response pathway are highly conserved in flowering plants and not limited to those that cold acclimate.
Jaglo, KR. Kleff, S. Amundsen, KL. Zhang, X. Haake, V. Zhang, JZ. Deits, T. Thomashow, MF.
Plant physiology.
2001.
127(3).
910-7.
The low temperature-responsive, Solanum CBF1 genes maintain high identity in their upstream regions in a genomic environment undergoing gene duplications, deletions, and rearrangements.
Plant molecular biology (2008)
Show / hide abstract
Show / hide abstract
Some plants like Arabidopsis thaliana increase in freezing tolerance when exposed to low nonfreezing temperatures, a process known as cold acclimation. Other plants including tomato, Solanum lycopersicum, are chilling sensitive and incur injury during prolonged low temperature exposure. A key initial event that occurs upon low temperature exposure is the induction of genes encoding the CBF transcription factors. In Arabidopsis three CBF genes, present in a tandemly-linked cluster, are induced by low temperatures. Tomato also harbors three tandemly-linked CBF genes, Sl-CBF3-CBF1-CBF2, but only one of these, Sl-CBF1, is low-temperature responsive. Here we report that Solanum species that are closely-allied to cultivated tomato essentially share this structural organization, but the locus is in a dynamic state of flux. Additional paralogs and in-frame deletions between adjacent genes occur, and the genomic regions flanking the CBF genes are dissimilar across Solanum species. Nevertheless, the CBF1 upstream region remains intact and highly conserved. This feature differed for CBF2 and CBF3, whose upstream regions were far less conserved. CBF1 was also the only low-temperature responsive gene in the cluster and its expression was greatly affected by a circadian clock. The tuber-bearing S. tuberosum and S. commersonii also harbored a fourth gene, CBF4, which was also low temperature responsive. CBF4 was physically linked to CBF5 in S. tuberosum, but CBF5 was absent from S. commersonii. Phylogenic analyses suggest that CBF5-CBF4 resulted from the duplication of the CBF3-CBF1-CBF2 cluster. DNA sequence motifs shared between the Solanum CBF1 and CBF4 upstream regions were identified, portions of which were also present in the Arabidopsis CBF1-3 upstream regions. These results suggest that much greater functional constraints are placed upon the Solanum CBF1 upstream regions over the other CBF upstream regions and that CBF4 has retained the capacity for low temperature responsiveness following the duplication event that gave rise to CBF4.
Pennycooke, JC. Cheng, H. Roberts, SM. Yang, Q. Rhee, SY. Stockinger, EJ.
Plant molecular biology.
2008.
67(5).
483-97.
Ethylene and cold participate in the regulation of LeCBF1 gene expression in postharvest tomato fruits.
FEBS letters (2009)
Show / hide abstract
Show / hide abstract
C-repeat/dehydration-responsive element binding factor (CBF) is a transcription factor regulating cold response in plants, of which little is known in fruits. We showed a double-peak expression pattern of Lycopersicon esculentum putative transcriptional activator CBF1 (LeCBF1) in mature green fruit. The peaks appeared at 2 and 16 h after subjection to cold storage (2 degrees C). The second peak was coincident with, and thus caused by a peak in endogenous ethylene production. We showed that LeCBF1 expression was regulated by exogenous ethylene and 1-methylcyclopropene, and was not expressed without cold induction. LeCBF1 expression was different in the five maturation stages of fruits, but expression peaked at 2 h at all stages.
Zhao, D. Shen, L. Fan, B. Yu, M. Zheng, Y. Lv, S. Sheng, J.
FEBS letters.
2009.
583(20).
3329-34.
Trans-species polymorphism and allele-specific expression in the CBF gene family of wild tomatoes.
Molecular biology and evolution (2012)
Show / hide abstract
Show / hide abstract
Abiotic stresses such as drought, extreme temperatures and salinity have a strong impact on plant adaptation. They act as selective forces on plant physiology and morphology. These selective pressures leave characteristic footprints that can be detected at the DNA sequence level using population genetic tools. Based on a candidate gene approach we investigated signatures of adaptation in two wild tomato species, Solanum peruvianum and S. chilense. These species are native to western South America and constitute a model system for studying adaptation, due to their ability to colonize diverse habitats and the available genetic resources. We have determined the selective forces acting on the CBF gene family, which consists of three genes, and is known to be involved in tolerance to abiotic stresses, in particular in cold tolerance. We also analyzed the expression pattern of these genes after drought and cold stresses. We found that CBF3 evolves under very strong purifying selection, CBF2 is under balancing selection in some populations of both species (S. peruvianum/Quicacha and S. chilense/Nazca) maintaining a trans-species polymorphism, and CBF1 is a pseudogene. Contrary to previous studies of cultivated tomatoes showing that only CBF1 was cold induced, we found that all three CBF genes are cold induced in wild tomatoes. All three genes are also drought induced. CBF2 exhibits an allele-specific expression pattern associated with the trans-species polymorphism.
Mboup, M. Fischer, I. Lainer, H. Stephan, W.
Molecular biology and evolution.
2012.
().
.
Ontology annotations (20)
Ontology annotations (20)
| [Add ontology annotations] |
[loading...]
Related views
Related views
|
- Genomic details
| User comments |
Please wait, checking for comments. (If comments do not show up, access them here)
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
List Comparison
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working

Links to external databases
Links to external databases
