This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
| Unigene Basic Information |
| Unigene ID: | SGN-U202556 |
| Unigene Build: | Capsicum annuum #1 |
| Date: | 2003-12-15 |
| Organism: | C.annuum |
| Alternative ID: | 202556 |
| mRNA sequence: | Length: 680 bp |
>SGN-U202556 Capsicum annuum #1 (1 members)
CGGCCGCTAAATTATCTTACTGTATATCAACAAAATTTCTCTTACAATCAATTCAACAATTTCGTAATGATCTCTGCCTAAATATTTGGC
TCTCCCCTTTTCAATCCATCTTTTGGAGTATGAGGAGGTAAGCTAGAAATCGGAACCATTGGCACATAACATTAGATCCTCCCTATTTGG
TAAAAATGATCGATCTCACAAGCGACCGTCAGAGAGGGATATTTAGAGTACATAACTGTATTTACAGGATTACATCATCAGCTATACAAA
ATGGTATCCATCATCCTACAGCTGCTCATGCTGCAAATAACCTGCATGCAGGAATAACTATGCTTCTACCGCTGCATCTTCAACTTCATG
ATCTGAATCTGCATCTGCTGCTGTGATCAATGAAGCTGACTGAATCTTCCCAGCATGCTCAAGACGCATCAGAATTACTCCTCTCGCATA
CCGAGACTGTATAGAAATGTCCCGAACTTTTATGCGATTCACAGTTCCACTCTGGCTCACGAGAACAACTTGCTCGTCACTCTCACCATC
CTCTCCAAAGGAGAAGCCTACAACGAATACTGCTGCCAGGCGATCTTCAGATGAAAACTTGTAACCAATTAAACCGACTCTATTTAAAGG
TGATGTACGGAATCTGCTAACTGGAACTCGCTTCCCATAACCACTTTCCG
[Blast] [AA Translation]
| Associated Loci (0) | None |
| Genomic locations (0) | None |
Library representation (1)
Library representation (1)
|
| Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
|---|---|---|---|---|
| Capsicum annuum | KS08 | Anther | 2304 | 1 |
mRNA member sequences (1)
mRNA member sequences (1)
|
To view details for a particular member sequence, click the SGN-E# identifier.
[Hide Image]
Markers Information (1)
Markers Information (1)
|
|
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
|
COSII Markers Information
COSII marker C2_At3g10690 was created with this unigene.
|
Expression Data (0)
Expression Data (0)
|
No expression data was found associated to this unigene
Annotations (manual: 0 | blast: 2 | go: 6 )
Annotations (manual: 0 | blast: 2 | go: 6 )
|
|
Manual annotations
None manual annotation was found for this unigene
|
Blast Annotations [Show All]
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GO Terms Annotations
|
Protein prediction analysis (2)
Protein prediction analysis (2)
|
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P37017 (171 Aa)
>SGN-P37017 (171 Aa)
ESGYGKRVPVSRFRTSPLNRVGLIGYKFSSEDRLAAVFVVGFSFGEDGESDEQVVLVSQSGTVNRIKVRDISIQSRYARGVILMRLEHAG
KIQSASLITAADADSDHEVEDAAVEAYYSCMQVICSMSSCRMMDTILYADDXNPVNTVMYSKYPSLTVACEIDHFYQIGRI
KIQSASLITAADADSDHEVEDAAVEAYYSCMQVICSMSSCRMMDTILYADDXNPVNTVMYSKYPSLTVACEIDHFYQIGRI
SignalP predicts non-secretion with a score of 0.146
- IPR006691 DNA gyrase C-terminal repeat, beta-propeller

>SGN-P156636 (116 Aa)
ESGYGKRVPVSRFRTSPLNRVGLIGYKFSSEDRLAAVFVVGFSFGEDGESDEQVVLVSQSGTVNRIKVRDISIQSRYARGVILMRLEHAG
KIQSASLITAADADSDHEVEDAAVEA
KIQSASLITAADADSDHEVEDAAVEA
SignalP predicts non-secretion with a score of 0.146
No InterPro domain matches or not analyzed.
Gene Family (6)
Gene Family (6)
|
| Family Build (I value*) | Family ID | Annotation** | # Members |
|---|---|---|---|
| 1.2 | 2467 | UPF0052 DNA_gyraseA_C TopoIV_A_Gneg TopoIV_A_Gpos DNA_topoisoIV DNA_gyrA RPEL_repeat | 7 |
| 2 | 24871 | UPF0052 DNA_gyraseA_C TopoIV_A_Gneg TopoIV_A_Gpos DNA_topoisoIV DNA_gyrA RPEL_repeat | 7 |
| 5 | 58917 | UPF0052 DNA_gyraseA_C TopoIV_A_Gneg TopoIV_A_Gpos DNA_topoisoIV DNA_gyrA RPEL_repeat | 7 |
| 1.1 | 101724 | DNA topoisomerase type IIA subunit B or N-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) | 43 |
| 2 | 122433 | DNA topoisomerase type IIA subunit B or N-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IIA central - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit A or C-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) WD40-like DNA gyrase/topoisomerase IV subunit A C-terminal beta-pinwheel - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase activity (GO:0003916) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IIA subunit A or C-terminal alpha-beta - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA gyrase subunit A - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) | 5 |
| 5 | 132621 | DNA topoisomerase type IIA subunit B or N-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IIA central - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit A or C-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) WD40-like DNA gyrase/topoisomerase IV subunit A C-terminal beta-pinwheel - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase activity (GO:0003916) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IIA subunit A or C-terminal alpha-beta - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA gyrase subunit A - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) | 5 |
*i value: controls inflation, a process to dissipate family clusters. At high i value, genes tend to be separated into different families.
**Annotation: the most common InterPro annotation(s) of the Arabidopsis members in the family.
| Preceding Unigenes (0) | None |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
Library representation (1)
Library representation (1)
