This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
| Unigene Basic Information |
| Unigene ID: | SGN-U204047 |
| Unigene Build: | Capsicum annuum #1 |
| Date: | 2003-12-15 |
| Organism: | C.annuum |
| Alternative ID: | 204047 |
| mRNA sequence: | Length: 279 bp |
>SGN-U204047 Capsicum annuum #1 (1 members)
CAGACATGTATCAGTTAAAGAAGCTGTTCTTCCATTTGAGAAATTCCAAGGCTGTGATGTGCTTCTTGGTCCTGAGATGCGCAGCACTGG
TGAGGTAATGGGTATCCACTACGAGTCATCAATTGCATTTGCCAAAGCACAAATTGCTGCTGGACAGAAAATGCCACTTTCAGGTACTCT
CTTCCTTAGCCTAAATGAAATGAAAAAACCCCATCTTACTACAATTGCTCGAGCCTTCTCGGGGCTTGGGTTTCAAATCATTGCAACTTC
TGGAACTGC
[Blast] [AA Translation]
| Associated Loci (0) | None |
| Genomic locations (0) | None |
Library representation (1)
Library representation (1)
|
| Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
|---|---|---|---|---|
| Capsicum annuum | KS10 | Hairy root | 2179 | 1 |
mRNA member sequences (1)
mRNA member sequences (1)
|
[Show Image]
Markers Information (0)
Markers Information (0)
|
|
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
|
COSII Markers Information
None cosii markers associated to this unigene.
|
Expression Data (0)
Expression Data (0)
|
No expression data was found associated to this unigene
Annotations (manual: 0 | blast: 2 | go: 0 )
Annotations (manual: 0 | blast: 2 | go: 0 )
|
|
Manual annotations
None manual annotation was found for this unigene
|
Blast Annotations [Show All]
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
GO Terms Annotations
No Gene Ontology annotation
|
Protein prediction analysis (2)
Protein prediction analysis (2)
|
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P38462 (93 Aa)
>SGN-P38462 (93 Aa)
RHVSVKEAVLPFEKFQGCDVLLGPEMRSTGEVMGIHYESSIAFAKAQIAAGQKMPLSGTLFLSLNEMKKPHLTTIARAFSGLGFQIIATS
GTA
GTA
SignalP predicts non-secretion with a score of 0.05
No InterPro domain matches or not analyzed.
Prediction based on longest six frame method
>SGN-P158162 (93 Aa)
RHVSVKEAVLPFEKFQGCDVLLGPEMRSTGEVMGIHYESSIAFAKAQIAAGQKMPLSGTLFLSLNEMKKPHLTTIARAFSGLGFQIIATS
GTA
GTA
SignalP predicts non-secretion with a score of 0.05
No InterPro domain matches or not analyzed.
Gene Family (6)
Gene Family (6)
|
| Family Build (I value*) | Family ID | Annotation** | # Members |
|---|---|---|---|
| 1.2 | 2411 | CPase_L_N PurK_ATP CarA_L_glu CPase_L_D3 MGS_like CoA_lig_beta CPase_L_D2 D_ala_D_ala Fe-ADH Dala_lig_Van AccC PurT CPase_L | 7 |
| 2 | 24781 | CPase_L_N PurK_ATP CarA_L_glu CPase_L_D3 MGS_like CoA_lig_beta CPase_L_D2 D_ala_D_ala Fe-ADH Dala_lig_Van AccC PurT CPase_L | 7 |
| 5 | 58810 | CPase_L_N PurK_ATP CarA_L_glu CPase_L_D3 MGS_like CoA_lig_beta CPase_L_D2 D_ala_D_ala Fe-ADH Dala_lig_Van AccC PurT CPase_L | 7 |
| 1.1 | 101898 | Carbamoyl-phosphate synthetase large chain N-terminal - Biological Process: metabolism (GO:0008152) - Molecular Function: ligase activity (GO:0016874) ATP-grasp fold - Molecular Function: catalytic activity (GO:0003824) Carbamoyl-phosphate synthase L chain ATP-binding - Molecular Function: ATP binding (GO:0005524) | 29 |
| 2 | 122103 | Carbamoyl-phosphate synthetase large chain N-terminal - Biological Process: metabolism (GO:0008152) - Molecular Function: ligase activity (GO:0016874) MGS-like Carbamoyl-phosphate synthase large subunit glutamine-dependent - Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086) - Biological Process: nitrogen compound metabolism (GO:0006807) Carbamoyl-phosphate synthetase large chain oligomerisation - Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086) - Cellular Component: cytoplasm (GO:0005737) - Biological Process: arginine biosynthesis (GO:0006526) - Biological Process: pyrimidine base biosynthesis (GO:0019856) Carbamoyl-phosphate synthase L chain ATP-binding - Molecular Function: ATP binding (GO:0005524) ATP-grasp fold - Molecular Function: catalytic activity (GO:0003824) Carbamoyl-phosphate synthetase large chain - Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086) | 5 |
| 5 | 133243 | Carbamoyl-phosphate synthetase large chain N-terminal - Biological Process: metabolism (GO:0008152) - Molecular Function: ligase activity (GO:0016874) MGS-like Carbamoyl-phosphate synthase large subunit glutamine-dependent - Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086) - Biological Process: nitrogen compound metabolism (GO:0006807) Carbamoyl-phosphate synthetase large chain oligomerisation - Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086) - Cellular Component: cytoplasm (GO:0005737) - Biological Process: arginine biosynthesis (GO:0006526) - Biological Process: pyrimidine base biosynthesis (GO:0019856) Carbamoyl-phosphate synthase L chain ATP-binding - Molecular Function: ATP binding (GO:0005524) ATP-grasp fold - Molecular Function: catalytic activity (GO:0003824) Carbamoyl-phosphate synthetase large chain - Molecular Function: carbamoyl-phosphate synthase activity (GO:0004086) | 4 |
*i value: controls inflation, a process to dissipate family clusters. At high i value, genes tend to be separated into different families.
**Annotation: the most common InterPro annotation(s) of the Arabidopsis members in the family.
| Preceding Unigenes (0) | None |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
Library representation (1)
Library representation (1)
