Solanum lycopersicum polypeptide Solyc03g113240.2.1
Polypeptide details
|
| Name | Type |
Length
191
|
Organism |
|
Description
polypeptide feature inferred from GFF3 feature
|
|
Location(s)
SL2.50ch03:63443246..63444419
|
|
GFF source
ITAG_eugene
|
Polypeptide sequence
| translated polypeptide sequence |
>Solyc03g113240.2.1 Unknown Protein (AHRD V1); contains Interpro domain(s) IPR009500 Protein of unknown function DUF1118
MAAATTSYLSNLEHGFSSKPRFRRPLIPSNTAPRILAMAPKKKVNKFDDNWKKQWFGAGLFYEGSEQVEVDVFKKLEKRKVLSTVEKAGLLSKAEELGFTLSSIEKLGLFSKAEELGLLSLLEKSASFSPAALASAALPILVAAILTIVFIPDDTVGLVAAQAVLAGALGLTAVGLFVGSVVLDGLQEAD*
MAAATTSYLSNLEHGFSSKPRFRRPLIPSNTAPRILAMAPKKKVNKFDDNWKKQWFGAGLFYEGSEQVEVDVFKKLEKRKVLSTVEKAGLLSKAEELGFTLSSIEKLGLFSKAEELGLLSLLEKSASFSPAALASAALPILVAAILTIVFIPDDTVGLVAAQAVLAGALGLTAVGLFVGSVVLDGLQEAD*
Genomic sequence(s)
| unprocessed genomic sequence underlying each location of this polypeptide |
Related features
|
| Features this polypeptide derives from |
| Type | Name | Location | Length | Strand | Phase |
|---|---|---|---|---|---|
| mRNA | Solyc03g113240.2.1 | SL2.50ch03:63443183..63444668 | 886 | + | n/a |
Add items to a list:
| Related views |
| User comments |
Please wait, checking for comments. (If comments do not show up, access them here)
Polypeptide details
Polypeptide details

