Arabidopsis thaliana polypeptide AT1G66380.1
|  Polypeptide details | 
| Name | Type | Organism | |
| Synonyms / aliases 
      MYB114, AtMYB114
     | Length 
      139
     | 
| Description 
      myb domain protein 114
     | 
| Location(s) TAIR10ch01:24757413..24758490 | 
| GFF source 
      
   TAIR10
     | 
|  Polypeptide sequence | translated polypeptide sequence | 
            
    
  >AT1G66380.1 myb domain protein 114
    
  
MEGSSKGLRKGAWTAEEDSLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGKFSSDEVDLLLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKTKIKRINIITPPNTPAQKVDIF
        
MEGSSKGLRKGAWTAEEDSLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGKFSSDEVDLLLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKTKIKRINIITPPNTPAQKVDIF
|  Genomic sequence(s) | unprocessed genomic sequence underlying each location of this polypeptide | 
|  Related features | 
| Features this polypeptide derives from | 
| Type | Name | Location | Length | Strand | Phase | 
|---|---|---|---|---|---|
| mRNA | AT1G66380.1 | TAIR10ch01:24757413..24758490 | 420 | + | n/a | 
    
    Add items to a list:
    
  
|  Related views | 
| User comments | 
Please wait, checking for comments.  (If comments do not show up, access them here)
 
           
           
         
    	      
	        
