Arabidopsis thaliana polypeptide AT4G21280.1

Polypeptide details  
Name Type Organism
Synonyms / aliases
PSBQ, PSBQA, PSBQ-1
Length
223
  
Description
photosystem II subunit QA
Location(s)
TAIR10ch04:11334446..11335587
GFF source
TAIR10
Polypeptide sequence translated polypeptide sequence 
>AT4G21280.1 photosystem II subunit QA

MASMGGLHGASPAVLEGSLKINGSSRLNGSGRVAVAQRSRLVVRAQQSEETSRRSVIGLVAAGLAGGSFVQAVLADAISIKVGPPPAPSGGLPGTDNSDQARDFALALKDRFYLQPLPPTEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTIISSKPKDEKKSLKDLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAKLG
Genomic sequence(s) unprocessed genomic sequence underlying each location of this polypeptide 
Related features  
Features this polypeptide derives from 
TypeNameLocationLengthStrandPhase
mRNAAT4G21280.1TAIR10ch04:11334402..11335773902+n/a
Add items to a list:

Related views  
http%3A%2F%2Fsolgenomics.net%3A8080%2Ffeature%2F18278506%2Fdetails feature 18278506
User comments 
Please wait, checking for comments. (If comments do not show up, access them here)