This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
| Unigene Basic Information |
| Unigene ID: | SGN-U293045 |
| Unigene Build: | Solanum tuberosum #4 |
| Date: | 2005-05-04 |
| Organism: | S.tuberosum |
| Alternative ID: | 293045 |
| mRNA sequence: | Length: 490 bp |
>SGN-U293045 Solanum tuberosum #4 (1 members)
CCTCGTGCCGATTCGGCACGAGGGAGAAATTTTCAGCAAAAATGTTTCCAAAAGTTCTCATGGTAGCAGAGAAGCCTAGCATTGCTTTAT
CGATTGCCTCAGTACTATCTGGTGCTCAAATGTCAACACGAAGAGGTAGTACAGAAGTCCATGAGTTCGATGCGATGTTTCTTGGATCAC
GTGCACATTATAAAGTGACTTCAGTGATTGGTCATGTTTTCAGCGTAGATTTTCCAGCAGCTTTTCAAGATTGGACAACTACAAATCCTT
CAGATCTTTTCCAGGCACCGATACTTAAGAAGGAAACAAACCCCAAGGCTCATATTTGTAGGCATCTAAGCCAGGAAGCTCGTGGTTGTA
CACATTTGGTGCTATGGTTGGACTGTGACCGTGAAAGAGAAAATATATGCTTTGAAGTTATAGAGTGCACTGGATTTCACGCAAGCGATG
GTAGAAAGAATTACCGTGCTCGATTCTCTTCTGTTACTGA
[Blast] [AA Translation]
| Associated Loci (0) | None |
| Genomic locations (0) | None |
Library representation (1)
Library representation (1)
|
| Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
|---|---|---|---|---|
| Solanum tuberosum | STM | mixed tissues | 14805 | 1 |
mRNA member sequences (1)
mRNA member sequences (1)
|
To view details for a particular member sequence, click the SGN-E# identifier.
[Hide Image]
Markers Information (0)
Markers Information (0)
|
|
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
|
COSII Markers Information
None cosii markers associated to this unigene.
|
Expression Data (0)
Expression Data (0)
|
No expression data was found associated to this unigene
Annotations (manual: 0 | blast: 3 | go: 0 )
Annotations (manual: 0 | blast: 3 | go: 0 )
|
|
Manual annotations
None manual annotation was found for this unigene
|
Blast Annotations [Show All]
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
GO Terms Annotations
No Gene Ontology annotation
|
Protein prediction analysis (2)
Protein prediction analysis (2)
|
Prediction based on longest six frame method
>SGN-P235241 (162 Aa)
>SGN-P235241 (162 Aa)
SCRFGTREKFSAKMFPKVLMVAEKPSIALSIASVLSGAQMSTRRGSTEVHEFDAMFLGSRAHYKVTSVIGHVFSVDFPAAFQDWTTTNPS
DLFQAPILKKETNPKAHICRHLSQEARGCTHLVLWLDCDRERENICFEVIECTGFHASDGRKNYRARFSSVT
DLFQAPILKKETNPKAHICRHLSQEARGCTHLVLWLDCDRERENICFEVIECTGFHASDGRKNYRARFSSVT
SignalP predicts non-secretion with a score of 0.161
No InterPro domain matches or not analyzed.
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P91290 (150 Aa)
MFPKVLMVAEKPSIALSIASVLSGAQMSTRRGSTEVHEFDAMFLGSRAHYKVTSVIGHVFSVDFPAAFQDWTTTNPSDLFQAPILKKETN
PKAHICRHLSQEARGCTHLVLWLDCDRERENICFEVIECTGFHASDGRKNYRARFSSVTX
PKAHICRHLSQEARGCTHLVLWLDCDRERENICFEVIECTGFHASDGRKNYRARFSSVTX
SignalP predicts non-secretion with a score of 0.293
No InterPro domain matches or not analyzed.
Gene Family (6)
Gene Family (6)
|
| Family Build (I value*) | Family ID | Annotation** | # Members |
|---|---|---|---|
| 1.2 | 1499 | TopoI_arch TopoIII_bact DNA_tpisomrase Toprim_dom DNA_topI_bact | 13 |
| 2 | 25221 | TopoI_arch TopoIII_bact DNA_tpisomrase Toprim_dom DNA_topI_bact | 7 |
| 5 | 59228 | TopoI_arch TopoIII_bact DNA_tpisomrase Toprim_dom DNA_topI_bact | 7 |
| 1.1 | 101663 | Zinc finger CCHC-type - Molecular Function: nucleic acid binding (GO:0003676) - Molecular Function: zinc ion binding (GO:0008270) | 49 |
| 2 | 121088 | DNA topoisomerase type IA - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase type I activity (GO:0003917) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IA DNA-binding - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase activity (GO:0003916) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) TOPRIM - Molecular Function: nucleic acid binding (GO:0003676) - Biological Process: DNA modification (GO:0006304) DNA topoisomerase type IA domain 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase activity (GO:0003916) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IA central - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) Toprim subdomain - Molecular Function: nucleic acid binding (GO:0003676) - Biological Process: DNA modification (GO:0006304) | 7 |
| 5 | 132522 | DNA topoisomerase type IA - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase type I activity (GO:0003917) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IA DNA-binding - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase activity (GO:0003916) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) TOPRIM - Molecular Function: nucleic acid binding (GO:0003676) - Biological Process: DNA modification (GO:0006304) DNA topoisomerase type IA domain 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase activity (GO:0003916) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IA central - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) Toprim subdomain - Molecular Function: nucleic acid binding (GO:0003676) - Biological Process: DNA modification (GO:0006304) | 5 |
*i value: controls inflation, a process to dissipate family clusters. At high i value, genes tend to be separated into different families.
**Annotation: the most common InterPro annotation(s) of the Arabidopsis members in the family.
Preceding Unigenes (1)
Preceding Unigenes (1)
|
| Unigene | Build |
|---|---|
| SGN-U263717 | Solanum tuberosum #3 |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
Library representation (1)
Library representation (1)
