This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
| Unigene Basic Information |
| Unigene ID: | SGN-U203934 |
| Unigene Build: | Capsicum annuum #1 |
| Date: | 2003-12-15 |
| Organism: | C.annuum |
| Alternative ID: | 203934 |
| mRNA sequence: | Length: 308 bp |
>SGN-U203934 Capsicum annuum #1 (1 members)
CACCATACTCCCCTTTCCCCATTTTCCCTTATATATTCATTTTCTTCACTCCAACTTTAAGAGCTCCTATTACTTGCTCTTACCCATAAC
TATATTTTTTCTCCATTCACCATGGAAAGCGCAACAACAGCACAAGCTCTATCCCGTATCGGCTTAGCTGGTCTAGCCGTCATGGGACAG
AACCTAGCGTTAAACATCGNTGAGAAAGGTTTCCCTATTTCCGTATATAACAGAACCACTTCTAAAGTTGACGAGACTTTAGATCGCGCT
GACAGTGAGGGAAAATTGCCGCTGATTGGGAAGTACGA
[Blast] [AA Translation]
| Associated Loci (0) | None |
| Genomic locations (0) | None |
Library representation (1)
Library representation (1)
|
| Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
|---|---|---|---|---|
| Capsicum annuum | KS09 | Young fruit (0.5-2 cm) | 4055 | 1 |
mRNA member sequences (1)
mRNA member sequences (1)
|
[Show Image]
Markers Information (0)
Markers Information (0)
|
|
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
|
COSII Markers Information
None cosii markers associated to this unigene.
|
Expression Data (0)
Expression Data (0)
|
No expression data was found associated to this unigene
Annotations (manual: 0 | blast: 2 | go: 2 )
Annotations (manual: 0 | blast: 2 | go: 2 )
|
|
Manual annotations
None manual annotation was found for this unigene
|
Blast Annotations [Show All]
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GO Terms Annotations
|
Protein prediction analysis (2)
Protein prediction analysis (2)
|
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P38352 (66 Aa)
>SGN-P38352 (66 Aa)
MESATTAQALSRIGLAGLAVMGQNLALNIXEKGFPISVYNRTTSKVDETLDRADSEGKLPLIGKYX
SignalP predicts non-secretion with a score of 0.347
- IPR006115 6-phosphogluconate dehydrogenase, NAD-binding

>SGN-P158048 (82 Aa)
ELLLLALTHNYIFSPFTMESATTAQALSRIGLAGLAVMGQNLALNIXEKGFPISVYNRTTSKVDETLDRADSEGKLPLIGKY
SignalP predicts non-secretion with a score of 0.338
No InterPro domain matches or not analyzed.
Gene Family (6)
Gene Family (6)
|
| Family Build (I value*) | Family ID | Annotation** | # Members |
|---|---|---|---|
| 1.2 | 293 | 3hydroxisobut_dh Tartro_sem_red Gnd_rel | 54 |
| 2 | 22721 | 3hydroxisobut_dh Tartro_sem_red 6PGD_decarbox Gnd_rel 6PGD_C 6PGD 6PGD_NAD | 21 |
| 5 | 56870 | 3hydroxisobut_dh Tartro_sem_red 6PGD_decarbox Gnd_rel 6PGD_C 6PGD 6PGD_NAD | 21 |
| 1.1 | 101660 | 6-phosphogluconate dehydrogenase NAD-binding - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) | 49 |
| 2 | 119322 | 6-phosphogluconate dehydrogenase C-terminal extension - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt oxidative branch (GO:0009051) - Molecular Function: NADP binding (GO:0050661) 6-phosphogluconate dehydrogenase C-terminal-like 6-phosphogluconate dehydrogenase C-terminal core - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt oxidative branch (GO:0009051) - Molecular Function: NADP binding (GO:0050661) 6-phosphogluconate dehydrogenase - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) 6-phosphogluconate dehydrogenase C-terminal - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) 6-phosphogluconate dehydrogenase NAD-binding - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) 6-phosphogluconate dehydrogenase decarboxylating - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) | 17 |
| 5 | 129666 | 6-phosphogluconate dehydrogenase C-terminal extension - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt oxidative branch (GO:0009051) - Molecular Function: NADP binding (GO:0050661) 6-phosphogluconate dehydrogenase C-terminal-like 6-phosphogluconate dehydrogenase C-terminal core - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt oxidative branch (GO:0009051) - Molecular Function: NADP binding (GO:0050661) 6-phosphogluconate dehydrogenase - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) 6-phosphogluconate dehydrogenase C-terminal - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) 6-phosphogluconate dehydrogenase NAD-binding - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) 6-phosphogluconate dehydrogenase decarboxylating - Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) - Biological Process: pentose-phosphate shunt (GO:0006098) | 17 |
*i value: controls inflation, a process to dissipate family clusters. At high i value, genes tend to be separated into different families.
**Annotation: the most common InterPro annotation(s) of the Arabidopsis members in the family.
| Preceding Unigenes (0) | None |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
Library representation (1)
Library representation (1)
