This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
| Unigene Basic Information |
| Unigene ID: | SGN-U282974 |
| Unigene Build: | Solanum tuberosum #4 |
| Date: | 2005-05-04 |
| Organism: | S.tuberosum |
| Alternative ID: | 282974 |
| mRNA sequence: | Length: 601 bp |
>SGN-U282974 Solanum tuberosum #4 (2 members)
TTTCTTAGTGGAGTTTATCACACCAATTGTGAAGGCTACTCATAAAAGTGGGAGGATACTGGCATTTTATACCATGCCTGAGTATGAGGC
ATGGAGAAGGAGTTTGGGTGCTACTTCAAGTGGTTGGTCTATCAAGTACTATAAGGGGTTGGGAACAAGTACTTCAAAGGAAGGAAAAGA
GTACTTCCAAGATCTTCAGAAACACAGGAAAGATTTTATCTGGGCAGATAACCAAGATGGGGAATCAATAGAACTTGCTTTCAGTAAGAA
GAAGATAGAAGCAAGGAAGAATTGGCTTAGACAATTTGAGCCCGGTACCCATCTAGACCAGAAAGAAAAGTACATCTGATACACCGAATT
TGTTAACAAAGAGCTTATTCTGTTTTCAATGGCTGACCTTCAAAGGTCTATTCCTTCAATGCTTGATGGTTTGAAACCGGGTCAAAGGAA
GATTCTGTTCTGTGCATTTAAGAAGAATTTTGTTAAGGAAGCAAAAGTTTCCCAATTTTCTGGTTATGTCTCTGAGCACTCAGCTTATCA
TCATGGTGAGCAGAGTCTTAGCAGCACCATCATTGGCATGGCACAAGACTATGTTGGCAGC
[Blast] [AA Translation]
| Associated Loci (0) | None |
| Genomic locations (0) | None |
 Library representation (2)
 Library representation (2)
|
| Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
|---|---|---|---|---|
| Solanum tuberosum | STM | mixed tissues | 14805 | 1 |
| Solanum tuberosum | cSTA | Axillary buds of stemp explants; swelling stolons; growing stolons; growing sink-tubers 1 to 3 days (plates 1-20), 4 to 6 days (plates 21-40), 7 to 10 days (plates 41-60) | 10537 | 1 |
| mRNA member sequences (2)
mRNA member sequences (2)
|
To view details for a particular member sequence, click the SGN-E# identifier.
| Markers Information (0)
Markers Information (0)
|
|
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
|
COSII Markers Information
None cosii markers associated to this unigene.
|
| Expression Data (0)
Expression Data (0)
|
No expression data was found associated to this unigene
| Annotations (manual: 0 | blast: 3 | go: 0 )
Annotations (manual: 0 | blast: 3 | go: 0 )
|
|
Manual annotations
None manual annotation was found for this unigene
|
Blast Annotations [Show All]
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
GO Terms Annotations
No Gene Ontology annotation
|
| Protein prediction analysis (2)
Protein prediction analysis (2)
|
Prediction based on longest six frame method
>SGN-P224936 (115 Aa)
>SGN-P224936 (115 Aa)
FLVEFITPIVKATHKSGRILAFYTMPEYEAWRRSLGATSSGWSIKYYKGLGTSTSKEGKEYFQDLQKHRKDFIWADNQDGESIELAFSKK
KIEARKNWLRQFEPGTHLDQKEKYI
KIEARKNWLRQFEPGTHLDQKEKYI
SignalP predicts non-secretion with a score of 0.21
No InterPro domain matches or not analyzed.
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P85569 (200 Aa)
FLVEFITPIVKATHKSGRILAFYTMPEYEAWRRSLGATSSGWSIKYYKGLGTSTSKEGKEYFQDLQKHRKDFIWADNQDGESIELAFSKK
KIEARKNWLRQFEPGTHLDQKEKSSDTPEFVNKELILFSMADLQRSIPSMLDGLKPGQRKILFCAFKKNFVKEAKVSQFSGYVSEHSAYH
HGEQSLSSTIIGMAQDYVGS
KIEARKNWLRQFEPGTHLDQKEKSSDTPEFVNKELILFSMADLQRSIPSMLDGLKPGQRKILFCAFKKNFVKEAKVSQFSGYVSEHSAYH
HGEQSLSSTIIGMAQDYVGS
SignalP predicts non-secretion with a score of 0.21
No InterPro domain matches or not analyzed.
| Gene Family (6)
Gene Family (6)
|
| Family Build (I value*) | Family ID | Annotation** | # Members |
|---|---|---|---|
| 1.2 | 372 | Myb_DNA_binding | 45 |
| 2 | 29236 | LEA TopoIV_B_Gneg CBFA_NFYB_topis TopoIV_A_Gpos DNA_topoisoII Topismrase_II TopoIV_B_Gpos ATPbind_ATPase DNA_topoisoIV DNA_gyrB DNA_gyrA | 3 |
| 5 | 63771 | LEA TopoIV_B_Gneg CBFA_NFYB_topis TopoIV_A_Gpos DNA_topoisoII Topismrase_II TopoIV_B_Gpos ATPbind_ATPase DNA_topoisoIV DNA_gyrB DNA_gyrA | 3 |
| 1.1 | 101724 | DNA topoisomerase type IIA subunit B or N-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) | 43 |
| 2 | 124705 | DNA topoisomerase type IIA subunit B or N-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase II eukaryotic-type - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit B or N-terminal alpha-beta - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA central - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit B conserved region - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) ATP-binding region ATPase-like - Molecular Function: ATP binding (GO:0005524) DNA topoisomerase type IIA subunit A or C-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit B region 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IIA subunit A or C-terminal alpha-beta - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) | 3 |
| 5 | 135048 | DNA topoisomerase type IIA subunit B or N-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase II eukaryotic-type - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit B or N-terminal alpha-beta - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA central - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit B conserved region - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) ATP-binding region ATPase-like - Molecular Function: ATP binding (GO:0005524) DNA topoisomerase type IIA subunit A or C-terminal - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) DNA topoisomerase type IIA subunit B region 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA topological change (GO:0006265) - Biological Process: DNA unwinding during replication (GO:0006268) DNA topoisomerase type IIA subunit A or C-terminal alpha-beta - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918) - Molecular Function: ATP binding (GO:0005524) - Cellular Component: chromosome (GO:0005694) - Biological Process: DNA metabolism (GO:0006259) - Biological Process: DNA topological change (GO:0006265) | 3 |
*i value: controls inflation, a process to dissipate family clusters. At high i value, genes tend to be separated into different families.
**Annotation: the most common InterPro annotation(s) of the Arabidopsis members in the family.
| Preceding Unigenes (1)
Preceding Unigenes (1)
|
| Unigene | Build |
|---|---|
| SGN-U258254 | Solanum tuberosum #3 |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
