This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
| Unigene Basic Information |
| Unigene ID: | SGN-U296744 |
| Unigene Build: | Solanum tuberosum #4 |
| Date: | 2005-05-04 |
| Organism: | S.tuberosum |
| Alternative ID: | 296744 |
| mRNA sequence: | Length: 240 bp |
>SGN-U296744 Solanum tuberosum #4 (1 members)
CTTCGAGGTGCCTCATTTGCTGGACTTCGTACTACAAGTGTGCGGAAGTTGTTACCTGAATCTTGGGGTTTCCTTTGTCCTGTTCACACA
CCTGATGGGGAGCCATGTGGGTTGCTTAATCATATGACTGCATCTTGCCGCATAACCTCATACTATGATTCAAAGGGCAATGTTAAAGAC
TTCTTCAAAATGCGGATGTCCATATTGAATGTGCTGATTGCAATTGGAATGACACCACCA
[Blast] [AA Translation]
| Associated Loci (0) | None |
| Genomic locations (0) | None |
 Library representation (1)
 Library representation (1)
|
| Organism | Library | Description | Library size (#ESTs) | Ests in this Unigene |
|---|---|---|---|---|
| Solanum tuberosum | cSTB | leaves and petioles 8 weeks old plants | 10327 | 1 |
| mRNA member sequences (1)
mRNA member sequences (1)
|
[Show Image]
| Markers Information (0)
Markers Information (0)
|
|
Unigene Mapped Marker Information
No member sequence or clone is mapped.
|
|
COSII Markers Information
None cosii markers associated to this unigene.
|
| Expression Data (0)
Expression Data (0)
|
No expression data was found associated to this unigene
| Annotations (manual: 0 | blast: 3 | go: 0 )
Annotations (manual: 0 | blast: 3 | go: 0 )
|
|
Manual annotations
None manual annotation was found for this unigene
|
Blast Annotations [Show All]
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
GO Terms Annotations
No Gene Ontology annotation
|
| Protein prediction analysis (2)
Protein prediction analysis (2)
|
Prediction based on longest six frame method
>SGN-P239033 (80 Aa)
>SGN-P239033 (80 Aa)
LRGASFAGLRTTSVRKLLPESWGFLCPVHTPDGEPCGLLNHMTASCRITSYYDSKGNVKDFFKMRMSILNVLIAIGMTPP
SignalP predicts non-secretion with a score of 0.318
No InterPro domain matches or not analyzed.
Prediction based on ESTScan [ Show ESTScan Detail]
>SGN-P94717 (80 Aa)
LRGASFAGLRTTSVRKLLPESWGFLCPVHTPDGEPCGLLNHMTASCRITSYYDSKGNVKDFFKMRMSILNVLIAIGMTPP
SignalP predicts non-secretion with a score of 0.318
No InterPro domain matches or not analyzed.
| Gene Family (6)
Gene Family (6)
|
| Family Build (I value*) | Family ID | Annotation** | # Members |
|---|---|---|---|
| 1.2 | 665 | RNA_pol_Rpb2_3 RNA_pol_Rpb2_6 RNA_pol_Rpb2_2 RNA_pol_B RNA_pol_Rpb2_7 | 28 |
| 2 | 22770 | RNA_pol_Rpb2_3 RNA_pol_Rpb2_6 RNA_pol_Rpb2_2 RNA_pol_B RNA_pol_Rpb2_7 | 20 |
| 5 | 61827 | RNA_pol_Rpb2_3 RNA_rec_mot RNA_pol_Rpb2_6 RNA_pol_Rpb2_2 RNA_pol_B RNA_pol_Rpb2_7 | 4 |
| 1.1 | 101927 | RNA polymerase Rpb2 domain 6 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 7 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase beta subunit - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 3 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) | 28 |
| 2 | 119070 | RNA polymerase Rpb2 domain 3 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 6 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase beta subunit - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 7 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) | 21 |
| 5 | 129582 | RNA polymerase Rpb2 domain 3 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 6 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 2 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase beta subunit - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) RNA polymerase Rpb2 domain 7 - Molecular Function: DNA binding (GO:0003677) - Molecular Function: DNA-directed RNA polymerase activity (GO:0003899) - Biological Process: transcription (GO:0006350) | 18 |
*i value: controls inflation, a process to dissipate family clusters. At high i value, genes tend to be separated into different families.
**Annotation: the most common InterPro annotation(s) of the Arabidopsis members in the family.
| Preceding Unigenes (1)
Preceding Unigenes (1)
|
| Unigene | Build |
|---|---|
| SGN-U265743 | Solanum tuberosum #3 |
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
| Attribute | Value |
|---|---|
| Project Name: | |
| Start Date: | |
| End Date: | |
| Event Type: | |
| Event Description: | |
| Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
